Skp1 Antibody (1H8) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related Skp1 Primary Antibodies

Order Details


    • Catalog Number
      H00006500-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Skp1 Antibody (1H8) [PerCP] Summary

Immunogen
SKP1A (NP_008861, 53 a.a. - 160 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
Specificity
SKP1A - S-phase kinase-associated protein 1A (p19A)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SKP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Skp1 Antibody (1H8) [PerCP]

  • Cyclin-A/CDK2-associated protein p19
  • EMC19p19skp1
  • MGC34403
  • OCP2OCP-2
  • OCP-IIS-phase kinase-associated protein 1A (p19A)
  • Organ of Corti protein 2
  • Organ of Corti protein II
  • p19Acyclin A/CDK2-associated p19
  • RNA polymerase II elongation factor-like protein OCP2
  • RNA polymerase II elongation factor-like protein
  • SKP1Acyclin A/CDK2-associated protein p19
  • S-phase kinase-associated protein 1
  • TCEB1LSIII
  • Transcription elongation factor B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
AF6817
Species: Hu
Applications: WB
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP2-55140
Species: Hu
Applications: ICC/IF
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006500-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Skp1 Antibody (H00006500-M01PCP) (0)

There are no publications for Skp1 Antibody (H00006500-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Skp1 Antibody (H00006500-M01PCP) (0)

There are no reviews for Skp1 Antibody (H00006500-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Skp1 Antibody (H00006500-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Skp1 Products

Bioinformatics Tool for Skp1 Antibody (H00006500-M01PCP)

Discover related pathways, diseases and genes to Skp1 Antibody (H00006500-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Skp1 Antibody (H00006500-M01PCP)

Discover more about diseases related to Skp1 Antibody (H00006500-M01PCP).
 

Pathways for Skp1 Antibody (H00006500-M01PCP)

View related products by pathway.

PTMs for Skp1 Antibody (H00006500-M01PCP)

Learn more about PTMs related to Skp1 Antibody (H00006500-M01PCP).
 

Research Areas for Skp1 Antibody (H00006500-M01PCP)

Find related products by research area.

Blogs on Skp1

There are no specific blogs for Skp1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Skp1 Antibody (1H8) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol SKP1