SKIV2L2 Antibody

Images

 
Western Blot: SKIV2L2 Antibody [NBP2-88281] - Host: Rabbit. Target Name: SKIV2L2. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SKIV2L2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SKIV2L2. Peptide sequence: FEGDSTTAAGTKKDKEKDKGKWKGPPGSADKAGKRFDGKLQSESTNNGKN The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MTREX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SKIV2L2 Antibody

  • ATP-dependent helicase SKIV2L2
  • Dob1
  • EC 3.6.1
  • EC 3.6.4.13
  • fSAP118
  • KIAA0052functional spliceosome-associated protein 118
  • MGC142069
  • Mtr4superkiller viralicidic activity 2-like 2
  • superkiller viralicidic activity 2-like 2 (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB943
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
AF4629
Species: Hu
Applications: WB
NBP2-71419
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
H00023471-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-47274
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-10064
Species: Hu
Applications: WB
H00022894-B01P
Species: Ch, Hu, Mu
Applications: ICC/IF, WB
NBP2-88011
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-97759
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB100-55409
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
NBP2-43686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010438-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-89175
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP1-57508
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87365
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-19388
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-88281
Species: Hu
Applications: WB

Publications for SKIV2L2 Antibody (NBP2-88281) (0)

There are no publications for SKIV2L2 Antibody (NBP2-88281).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SKIV2L2 Antibody (NBP2-88281) (0)

There are no reviews for SKIV2L2 Antibody (NBP2-88281). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SKIV2L2 Antibody (NBP2-88281) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SKIV2L2 Products

Bioinformatics Tool for SKIV2L2 Antibody (NBP2-88281)

Discover related pathways, diseases and genes to SKIV2L2 Antibody (NBP2-88281). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SKIV2L2 Antibody (NBP2-88281)

Discover more about diseases related to SKIV2L2 Antibody (NBP2-88281).
 

Pathways for SKIV2L2 Antibody (NBP2-88281)

View related products by pathway.

PTMs for SKIV2L2 Antibody (NBP2-88281)

Learn more about PTMs related to SKIV2L2 Antibody (NBP2-88281).

Blogs on SKIV2L2

There are no specific blogs for SKIV2L2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SKIV2L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTREX