SIX5 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIX5. Source: E. coli
Amino Acid Sequence: VVPTSQVVTLPQAVGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFLLANPVSGSPIVTGVAVQQGKIILTATFPTSMLVSQVLP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SIX5 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85009. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for SIX5 Recombinant Protein Antigen
Background
Six5 (homeobox protein SIX5), also known as SIX5, BOR2 or DMAHP (DM locus-associated homeodomain protein), is a transcription factor that is expressed in various structures of the adult eye. Localized to the cytoplasm in early development and to the nucleus in the later stages of development,Six5 is involved in regulation of organogenesis and in maintenance of retinal formation. Six5 is able to bind the 5'-TCA[AG][AG]TTNC-3' DNA sequence found in the myogenin and IGFBP5 promoters and, through this binding, can control transcription of the associated mRNA. Six5 is regulated via association with DACH1 (dachshund homolog 1) and is co-activated by the EYA (eyes absent) proteins. Defects in the gene encoding Six5 are the cause of branchiooto- renal syndrome type 2 (BOR2), an autosomal disorder characterized by hearing loss, a deep overbite and myopia. Two isoforms exist due to alternative splicing events.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: AC
Publications for SIX5 Recombinant Protein Antigen (NBP1-85009PEP) (0)
There are no publications for SIX5 Recombinant Protein Antigen (NBP1-85009PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SIX5 Recombinant Protein Antigen (NBP1-85009PEP) (0)
There are no reviews for SIX5 Recombinant Protein Antigen (NBP1-85009PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for SIX5 Recombinant Protein Antigen (NBP1-85009PEP) (0)
Additional SIX5 Products
Blogs on SIX5