SIX5 Recombinant Protein Antigen

Images

 
There are currently no images for SIX5 Recombinant Protein Antigen (NBP1-85009PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SIX5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIX5.

Source: E. coli

Amino Acid Sequence: VVPTSQVVTLPQAVGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFLLANPVSGSPIVTGVAVQQGKIILTATFPTSMLVSQVLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SIX5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85009.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SIX5 Recombinant Protein Antigen

  • BOR2
  • DM locus-associated homeodomain protein
  • DMAHPsine oculis homeobox homolog 5 (Drosophila)
  • dystrophia myotonica-associated homeodomain protein
  • homeobox protein SIX5
  • sine oculis homeobox (Drosophila) homolog 5
  • Sine oculis homeobox homolog 5
  • SIX homeobox 5

Background

Six5 (homeobox protein SIX5), also known as SIX5, BOR2 or DMAHP (DM locus-associated homeodomain protein), is a transcription factor that is expressed in various structures of the adult eye. Localized to the cytoplasm in early development and to the nucleus in the later stages of development,Six5 is involved in regulation of organogenesis and in maintenance of retinal formation. Six5 is able to bind the 5'-TCA[AG][AG]TTNC-3' DNA sequence found in the myogenin and IGFBP5 promoters and, through this binding, can control transcription of the associated mRNA. Six5 is regulated via association with DACH1 (dachshund homolog 1) and is co-activated by the EYA (eyes absent) proteins. Defects in the gene encoding Six5 are the cause of branchiooto- renal syndrome type 2 (BOR2), an autosomal disorder characterized by hearing loss, a deep overbite and myopia. Two isoforms exist due to alternative splicing events.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85010
Species: Hu
Applications: IHC,  IHC-P
NBP2-87382
Species: Hu
Applications: IHC,  IHC-P, WB
H00051804-M09
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
NBP1-84264
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49548
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB66861
Species: Hu
Applications: ICC, WB
NBP2-92206
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-52030
Species: Hu
Applications: PEP-ELISA, WB
H00010736-M01
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, KD, WB
H00006496-M04
Species: Hu
Applications: ELISA, WB
NBP1-89951
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-84026
Species: Hu
Applications: IHC,  IHC-P, WB
MAB2457
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-49409
Species: Hu
Applications: IHC,  IHC-P
NBP1-85009PEP
Species: Hu
Applications: AC

Publications for SIX5 Recombinant Protein Antigen (NBP1-85009PEP) (0)

There are no publications for SIX5 Recombinant Protein Antigen (NBP1-85009PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIX5 Recombinant Protein Antigen (NBP1-85009PEP) (0)

There are no reviews for SIX5 Recombinant Protein Antigen (NBP1-85009PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SIX5 Recombinant Protein Antigen (NBP1-85009PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIX5 Products

Blogs on SIX5

There are no specific blogs for SIX5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SIX5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SIX5