Recombinant Human Sirtuin 3/SIRT3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Sirtuin 3/SIRT3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 297-399 of Human Sirtuin 3/SIRT3

Source: Wheat Germ

Amino Acid Sequence: PLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SIRT3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.07 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sirtuin 3/SIRT3 Protein

  • EC 3.5.1
  • EC 3.5.1.-
  • hSIRT3
  • mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase
  • NAD-dependent deacetylase sirtuin-3, mitochondrial
  • SIR2L3
  • SIR2L3silent mating type information regulation 2, S.cerevisiae, homolog 3
  • sir2-like 3
  • SIR2-like protein 3
  • SIRT3
  • sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)
  • sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 3
  • Sirtuin 3
  • sirtuin type 3

Background

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-1406
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56372
Species: Hu, Mu, Rt
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-23795
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-239
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-2522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01) (0)

There are no publications for Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01) (0)

There are no reviews for Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01)

Discover related pathways, diseases and genes to Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01)

Discover more about diseases related to Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01).
 

Pathways for Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01)

View related products by pathway.

PTMs for Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01)

Learn more about PTMs related to Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01).
 

Research Areas for Sirtuin 3/SIRT3 Partial Recombinant Protein (H00023410-Q01)

Find related products by research area.

Blogs on Sirtuin 3/SIRT3

There are no specific blogs for Sirtuin 3/SIRT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Sirtuin 3/SIRT3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRT3
Entrez