Recombinant Human Sirtuin 1/SIRT1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Sirtuin 1/SIRT1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 456-555 of Human SIRT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS

Protein/Peptide Type
Partial Recombinant Protein
Gene
SIRT1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sirtuin 1/SIRT1 Protein

  • EC 3.5.1
  • S. cerevisiae, homolog) 1
  • SIR2alpha
  • SIR2L1
  • SIR2-like protein 1
  • SIRT1
  • Sirtuin 1

Background

SIRT1 - sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31029
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P

Publications for Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01) (0)

There are no publications for Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01) (0)

There are no reviews for Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sirtuin 1/SIRT1 Products

Bioinformatics Tool for Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01)

Discover related pathways, diseases and genes to Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01)

Discover more about diseases related to Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01).
 

Pathways for Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01)

View related products by pathway.

PTMs for Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01)

Learn more about PTMs related to Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01).
 

Research Areas for Sirtuin 1/SIRT1 Partial Recombinant Protein (H00023411-Q01)

Find related products by research area.

Blogs on Sirtuin 1/SIRT1

There are no specific blogs for Sirtuin 1/SIRT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Sirtuin 1/SIRT1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRT1
Entrez