SIRT7 Recombinant Protein Antigen

Images

 
There are currently no images for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SIRT7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIRT7

Source: E.coli

Amino Acid Sequence: LVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADLSEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SIRT7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21247. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SIRT7 Recombinant Protein Antigen

  • EC 3.5.1.-
  • MGC126840
  • MGC126842
  • silent mating type information regulation 2, S.cerevisiae, homolog 7
  • SIR2L7
  • SIR2L7NAD-dependent deacetylase sirtuin-7
  • SIR2-like protein 7
  • sir2-related protein type 7
  • sirtuin (silent mating type information regulation 2 homolog) 7 (S. cerevisiae)
  • sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 7
  • Sirtuin 7
  • sirtuin type 7

Background

SIRT7 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. SIRT7 is included in class IV. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT7 is included in class IV of the sirtuin family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87039
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-51641
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, WB
NB100-2524
Species: Hu
Applications: ICC/IF, WB
NBP3-02984
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KO, WB
NBP2-74199
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, KO, WB
NB100-1406
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
291-G1
Species: Hu
Applications: BA
NBP3-46113
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
NBP2-45952
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB600-279
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-89692
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-61050
Species: Hu
Applications: IHC,  IHC-P, IP, PLA, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-07996
Species: Hu
Applications: WB
NBL1-11570
Species: Hu
Applications: WB
NBP3-21247PEP
Species: Hu
Applications: AC

Publications for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP) (0)

There are no publications for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP) (0)

There are no reviews for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIRT7 Products

Research Areas for SIRT7 Recombinant Protein Antigen (NBP3-21247PEP)

Find related products by research area.

Blogs on SIRT7

There are no specific blogs for SIRT7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SIRT7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SIRT7