SIRT4 Antibody - BSA Free

Western Blot: SIRT4 Antibody [NBP1-80746] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SIRT4 Antibody [NBP1-80746] - Staining in human testis and pancreas tissues using anti-SIRT4 antibody. Corresponding SIRT4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SIRT4 Antibody [NBP1-80746] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: SIRT4 Antibody [NBP1-80746] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SIRT4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIRT4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SIRT4 Protein (NBP1-80746PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SIRT4 Antibody - BSA Free

• EC 2.4.2.-
• EC 3.5.1
• MGC130046
• MGC130047
• MGC57437
• SIR2L4
• SIR2L4NAD-dependent ADP-ribosyltransferase sirtuin-4
• sir2-like 4
• SIR2-like protein 4
• SIRT4
• sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
• sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 4
• Sirtuin 4
• sirtuin type 4

Background

SIRT4 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SIRT4 Antibody (NBP1-80746)(2)

Publications using NBP1-80746

• Wenzek C, Steinbach P, WirsdOrfer F et al. CD47 restricts antiviral function of alveolar macrophages during influenza virus infection iScience 2022-12-22 [PMID: 36437873] (FLOW, Mouse)
• Meister ML, Najjar RS, Danh JP et al. Berry consumption mitigates the hypertensive effects of a high-fat, high-sucrose diet via attenuation of renal and aortic AT1R expression resulting in improved endothelium-derived NO bioavailability The Journal of nutritional biochemistry 2022-11-23 [PMID: 36435288] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: SIRT4
• Entrez:
  • 23409(Human)
• Uniprot:
  • Q9Y6E7(Human)