SIRT4 Antibody


Western Blot: SIRT4 Antibody [NBP1-80003] - Sample Tissue: Human HepG2 Antibody Dilution: 1.0 ug/ml
Western Blot: SIRT4 Antibody [NBP1-80003] - Human Small Intestine, concentration 0.2-1 ug/ml.
Western Blot: SIRT4 Antibody [NBP1-80003] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Product Details

Product Discontinued
View other related SIRT4 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SIRT4 Antibody Summary

Synthetic peptide directed towards the N terminal of human SIRT4. Peptide sequence ASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYAR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against SIRT4 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SIRT4 Antibody

  • EC 2.4.2.-
  • EC 3.5.1
  • MGC130046
  • MGC130047
  • MGC57437
  • SIR2L4NAD-dependent ADP-ribosyltransferase sirtuin-4
  • sir2-like 4
  • SIR2-like protein 4
  • sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
  • sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 4
  • sirtuin 4
  • sirtuin type 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Ce
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
Species: Hu

Publications for SIRT4 Antibody (NBP1-80003) (0)

There are no publications for SIRT4 Antibody (NBP1-80003).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIRT4 Antibody (NBP1-80003) (0)

There are no reviews for SIRT4 Antibody (NBP1-80003). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIRT4 Antibody (NBP1-80003) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SIRT4 Antibody (NBP1-80003)

Discover related pathways, diseases and genes to SIRT4 Antibody (NBP1-80003). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIRT4 Antibody (NBP1-80003)

Discover more about diseases related to SIRT4 Antibody (NBP1-80003).

Pathways for SIRT4 Antibody (NBP1-80003)

View related products by pathway.

PTMs for SIRT4 Antibody (NBP1-80003)

Learn more about PTMs related to SIRT4 Antibody (NBP1-80003).

Research Areas for SIRT4 Antibody (NBP1-80003)

Find related products by research area.

Blogs on SIRT4

There are no specific blogs for SIRT4, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SIRT4 Antibody and receive a gift card or discount.


Gene Symbol SIRT4