SIL1 Antibody


Western Blot: SIL1 Antibody [NBP1-59375] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: SIL1 Antibody [NBP1-59375] - Human Adult Testis Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody more
Western Blot: SIL1 Antibody [NBP1-59375] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Western Blot: SIL1 Antibody [NBP1-59375] - Antibody Titration: 1 ug/ml Human heart.
Immunohistochemistry: SIL1 Antibody [NBP1-59375] - Human Adult Prostate Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody more

Product Details

Product Discontinued
View other related SIL1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SIL1 Antibody Summary

Synthetic peptides corresponding to SIL1(SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae)) The peptide sequence was selected from the C terminal of SIL1. Peptide sequence KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against SIL1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SIL1 Antibody

  • BAPMarinesco-Sjogren syndrome
  • BiP-associated protein
  • MSS
  • nucleotide exchange factor SIL1
  • SIL1 homolog, endoplasmic reticulum chaperone (S. cerevisiae)
  • ULG5


SIL1 is a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in its gene have been associated with Marinesco-Sjogren syndrome.This gene encodes a resident endoplasmic reticulum (ER), N-linked glycoprotein with an N-terminal ER targeting sequence, 2 putative N-glycosylation sites, and a C-terminal ER retention signal. This protein functions as a nucleotide exchange factor for another unfolded protein response protein. Mutations in this gene have been associated with Marinesco-Sjogren syndrome. Alternate transcriptional splice variants have been characterized.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB
Species: Hu
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC

Publications for SIL1 Antibody (NBP1-59375) (0)

There are no publications for SIL1 Antibody (NBP1-59375).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIL1 Antibody (NBP1-59375) (0)

There are no reviews for SIL1 Antibody (NBP1-59375). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIL1 Antibody (NBP1-59375) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SIL1 Products

Bioinformatics Tool for SIL1 Antibody (NBP1-59375)

Discover related pathways, diseases and genes to SIL1 Antibody (NBP1-59375). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIL1 Antibody (NBP1-59375)

Discover more about diseases related to SIL1 Antibody (NBP1-59375).

Pathways for SIL1 Antibody (NBP1-59375)

View related products by pathway.

PTMs for SIL1 Antibody (NBP1-59375)

Learn more about PTMs related to SIL1 Antibody (NBP1-59375).

Blogs on SIL1

There are no specific blogs for SIL1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SIL1 Antibody and receive a gift card or discount.


Gene Symbol SIL1