Signal sequence receptor delta Antibody (2D3) [PE]

Images

 

Order Details


    • Catalog Number
      H00006748-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Signal sequence receptor delta Antibody (2D3) [PE] Summary

Immunogen
SSR4 (AAH03371, 24 a.a. - 173 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EACLEPQITPSYYTTSDAVISTETVLIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA
Localization
Endoplasmic reticulum
Specificity
SSR4 - signal sequence receptor, delta (translocon-associated protein delta)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SSR4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Signal sequence receptor delta Antibody (2D3) [PE]

  • signal sequence receptor, delta (translocon-associated protein delta)
  • SSR-delta
  • translocon-associated protein delta
  • translocon-associated protein subunit delta
  • TRAP-delta
  • TRAPDSignal sequence receptor subunit delta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86094
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
AF1007
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP2-57960
Species: Hu
Applications: ICC/IF
H00005721-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46439
Species: Hu
Applications: WB, IHC
NBP2-31703
Species: Hu
Applications: IHC, IHC-P
NBP1-91780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-89038
Species: Hu
Applications: IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46790
Species: Hu
Applications: IHC, IHC-P
H00010488-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-13419
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for Signal sequence receptor delta Antibody (H00006748-M01PE) (0)

There are no publications for Signal sequence receptor delta Antibody (H00006748-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Signal sequence receptor delta Antibody (H00006748-M01PE) (0)

There are no reviews for Signal sequence receptor delta Antibody (H00006748-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Signal sequence receptor delta Antibody (H00006748-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Signal sequence receptor delta Products

Bioinformatics Tool for Signal sequence receptor delta Antibody (H00006748-M01PE)

Discover related pathways, diseases and genes to Signal sequence receptor delta Antibody (H00006748-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Signal sequence receptor delta Antibody (H00006748-M01PE)

Discover more about diseases related to Signal sequence receptor delta Antibody (H00006748-M01PE).
 

Pathways for Signal sequence receptor delta Antibody (H00006748-M01PE)

View related products by pathway.

PTMs for Signal sequence receptor delta Antibody (H00006748-M01PE)

Learn more about PTMs related to Signal sequence receptor delta Antibody (H00006748-M01PE).

Blogs on Signal sequence receptor delta

There are no specific blogs for Signal sequence receptor delta, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Signal sequence receptor delta Antibody (2D3) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol SSR4