Recombinant Human SIGLECL12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SIGLECL12 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 503 - 595 of Human SIGLEC12 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RSCRKKSARPAVGVGDTGMEDANAVRGSASQGPLIESPADDSPPHHAPPALATPSPEEGEIQYASLSFHKARPQYPQEQEAIGYEYSEINIPK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SIGLEC12
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SIGLECL12 Protein

  • FLJ38600
  • S2V
  • sialic acid binding Ig-like lectin 12
  • sialic acid-binding Ig-like lectin 12
  • Siglec-12
  • SIGLECL1
  • SIGLECL1Sialic acid-binding Ig-like lectin-like 1
  • SIGLEC-like 1
  • Siglec-XII
  • SLG
  • SLGSiglec-L1

Background

Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor. This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF2987
Species: Hu
Applications: WB, ICC
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38045
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13279
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF5944
Species: Hu, Mu, Rt
Applications: WB
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP2-07799
Species: Hu
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut

Publications for SIGLECL12 Partial Recombinant Protein (H00089858-Q02) (0)

There are no publications for SIGLECL12 Partial Recombinant Protein (H00089858-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIGLECL12 Partial Recombinant Protein (H00089858-Q02) (0)

There are no reviews for SIGLECL12 Partial Recombinant Protein (H00089858-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIGLECL12 Partial Recombinant Protein (H00089858-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIGLECL12 Products

Bioinformatics Tool for SIGLECL12 Partial Recombinant Protein (H00089858-Q02)

Discover related pathways, diseases and genes to SIGLECL12 Partial Recombinant Protein (H00089858-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIGLECL12 Partial Recombinant Protein (H00089858-Q02)

Discover more about diseases related to SIGLECL12 Partial Recombinant Protein (H00089858-Q02).
 

Pathways for SIGLECL12 Partial Recombinant Protein (H00089858-Q02)

View related products by pathway.

Blogs on SIGLECL12

There are no specific blogs for SIGLECL12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SIGLECL12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SIGLEC12
Entrez