Recombinant Human SIGLECL12 Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, PA, AP

Recombinant Human SIGLECL12 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 503-595 of Human SIGLECL12
  
  

  Source: Wheat Germ

  Amino Acid Sequence: RSCRKKSARPAVGVGDTGMEDANAVRGSASQGPLIESPADDSPPHHAPPALATPSPEEGEIQYASLSFHKARPQYPQEQEAIGYEYSEINIPK

• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: SIGLEC12
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Application Notes: This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
• Theoretical MW: 35.97 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SIGLECL12 Protein

• FLJ38600
• S2V
• sialic acid binding Ig-like lectin 12
• sialic acid-binding Ig-like lectin 12
• Siglec-12
• SIGLECL1
• SIGLECL1Sialic acid-binding Ig-like lectin-like 1
• SIGLEC-like 1
• Siglec-XII
• SLG
• SLGSiglec-L1

Background

Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor. This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SIGLEC12
• Entrez:
  • 89858(Human)
  • 83382(Mouse)