SIGLECL1 Antibody

Images

 
Western Blot: SIGLEC1 Antibody [NBP2-14794] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: SIGLEC1 Antibody [NBP2-14794] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: SIGLEC1 Antibody [NBP2-14794] - Staining of human rectum shows strong nuclear/ or nucleolar positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related SIGLECL1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-14794
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SIGLECL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HIRKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVVATFSESRIL E
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SIGLECL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SIGLECL1 Antibody

  • C19orf75
  • CD169
  • Siglec1
  • Siglec-1
  • SIGLECL1 SIGLEC family like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB2859
Species: Hu
Applications: Flow, CyTOF-ready
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-14794
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SIGLECL1 Antibody (NBP2-14794) (0)

There are no publications for SIGLECL1 Antibody (NBP2-14794).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIGLECL1 Antibody (NBP2-14794) (0)

There are no reviews for SIGLECL1 Antibody (NBP2-14794). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SIGLECL1 Antibody (NBP2-14794) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIGLECL1 Products

Bioinformatics Tool for SIGLECL1 Antibody (NBP2-14794)

Discover related pathways, diseases and genes to SIGLECL1 Antibody (NBP2-14794). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SIGLECL1

There are no specific blogs for SIGLECL1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIGLECL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIGLECL1
Entrez