Siglec-9 Antibody

Product Details

Product Discontinued
View other related Siglec-9 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Siglec-9 Antibody Summary

Synthetic peptides corresponding to SIGLEC9(sialic acid binding Ig-like lectin 9) The peptide sequence was selected from the C terminal of SIGLEC9. Peptide sequence PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified

Application Notes
This is a rabbit polyclonal antibody against SIGLEC9 and was validated on Western blot.

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

SIGLEC9 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, Neut
Species: Hu
Applications: Flow, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: Flow
Species: Hu, Mu, Rt
Applications: WB, Simple Western
Species: Hu
Applications: WB, Flow, Block
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, Flow

Publications for Siglec-9 Antibody (NBP1-59275) (0)

There are no publications for Siglec-9 Antibody (NBP1-59275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Siglec-9 Antibody (NBP1-59275) (0)

There are no reviews for Siglec-9 Antibody (NBP1-59275). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for Siglec-9 Antibody (NBP1-59275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Siglec-9 Antibody Products

Related Products by Gene

Bioinformatics Tool for Siglec-9 Antibody (NBP1-59275)

Discover related pathways, diseases and genes to Siglec-9 Antibody (NBP1-59275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Siglec-9 Antibody (NBP1-59275)

Discover more about diseases related to Siglec-9 Antibody (NBP1-59275).

Pathways for Siglec-9 Antibody (NBP1-59275)

View related products by pathway.

PTMs for Siglec-9 Antibody (NBP1-59275)

Learn more about PTMs related to Siglec-9 Antibody (NBP1-59275).

Blogs on Siglec-9

There are no specific blogs for Siglec-9, but you can read our latest blog posts.

Contact Information

Product PDFs

Gene Symbol SIGLEC9

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59275 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.