Siglec-9 Antibody

Images

 
Western Blot: SIGLEC9 Antibody [NBP1-59275] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Siglec-9 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59275
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Siglec-9 Antibody Summary

Immunogen
Synthetic peptides corresponding to SIGLEC9(sialic acid binding Ig-like lectin 9) The peptide sequence was selected from the C terminal of SIGLEC9. Peptide sequence PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA.
Clonality
Polyclonal
Host
Rabbit
Gene
SIGLEC9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SIGLEC9 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Siglec-9 Antibody

  • CD329
  • CDw329
  • FOAP-9
  • OBBP-Like
  • Protein FOAP-9
  • sialic acid binding Ig-like lectin 9
  • sialic acid-binding Ig-like lectin 9
  • Siglec9
  • Siglec-9

Background

SIGLEC9 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
AF1072
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
MAB7975
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
AF2130
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-84590
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Siglec-9 Antibody (NBP1-59275) (0)

There are no publications for Siglec-9 Antibody (NBP1-59275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Siglec-9 Antibody (NBP1-59275) (0)

There are no reviews for Siglec-9 Antibody (NBP1-59275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Siglec-9 Antibody (NBP1-59275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Siglec-9 Products

Bioinformatics Tool for Siglec-9 Antibody (NBP1-59275)

Discover related pathways, diseases and genes to Siglec-9 Antibody (NBP1-59275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Siglec-9 Antibody (NBP1-59275)

Discover more about diseases related to Siglec-9 Antibody (NBP1-59275).
 

Pathways for Siglec-9 Antibody (NBP1-59275)

View related products by pathway.

PTMs for Siglec-9 Antibody (NBP1-59275)

Learn more about PTMs related to Siglec-9 Antibody (NBP1-59275).

Blogs on Siglec-9

There are no specific blogs for Siglec-9, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Siglec-9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIGLEC9
Entrez
Uniprot