Recombinant Human Siglec-7/CD328 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Siglec-7/CD328 Peptides and Proteins

Order Details


    • Catalog Number
      H00027036-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Siglec-7/CD328 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 377-466 of Human SIGLEC7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RSCRKKSARPAADVGDIGMKDANTIRGSASQGNLTESWADDNPRHHGLAAHSSGEEREIQYAPLSFHKGEPQDLSGQEATNNEYSEIKIP

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
SIGLEC7

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Siglec-7/CD328 Protein

  • Adhesion inhibitory receptor molecule 1
  • adhesion inhibitory receptor molecule 1, siglec-7
  • AIRM1
  • AIRM-1
  • AIRM1QA79 membrane protein
  • CD328 antigen
  • CD328
  • CDw328
  • D-siglec
  • p75
  • p75/AIRM1
  • QA79
  • sialic acid binding Ig-like lectin 7
  • sialic acid binding immunoglobulin-like lectin 7
  • sialic acid-binding Ig-like lectin 7
  • Siglec7
  • Siglec-7

Background

SIGLEC7 - sialic acid binding Ig-like lectin 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
MAB6638
Species: Hu, Mu, Rt
Applications: WB
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00027036-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Siglec-7/CD328 Partial Recombinant Protein (H00027036-Q01) (0)

There are no publications for Siglec-7/CD328 Partial Recombinant Protein (H00027036-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Siglec-7/CD328 Partial Recombinant Protein (H00027036-Q01) (0)

There are no reviews for Siglec-7/CD328 Partial Recombinant Protein (H00027036-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Siglec-7/CD328 Partial Recombinant Protein (H00027036-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Siglec-7/CD328 Products

Bioinformatics Tool for Siglec-7/CD328 Partial Recombinant Protein (H00027036-Q01)

Discover related pathways, diseases and genes to Siglec-7/CD328 Partial Recombinant Protein (H00027036-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Siglec-7/CD328 Partial Recombinant Protein (H00027036-Q01)

Discover more about diseases related to Siglec-7/CD328 Partial Recombinant Protein (H00027036-Q01).
 

Pathways for Siglec-7/CD328 Partial Recombinant Protein (H00027036-Q01)

View related products by pathway.

PTMs for Siglec-7/CD328 Partial Recombinant Protein (H00027036-Q01)

Learn more about PTMs related to Siglec-7/CD328 Partial Recombinant Protein (H00027036-Q01).

Blogs on Siglec-7/CD328

There are no specific blogs for Siglec-7/CD328, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Siglec-7/CD328 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SIGLEC7
Entrez