Recombinant Human Siglec-6/CD327 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Siglec-6/CD327 Peptides and Proteins

Order Details


    • Catalog Number
      H00000946-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Siglec-6/CD327 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-437 of Human SIGLEC6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK

Protein/Peptide Type
Recombinant Protein
Gene
SIGLEC6

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Siglec-6/CD327 Protein

  • CD327 antigen
  • CD327
  • CD33 antigen-like 1
  • CD33L1
  • CD33L1OBBP1CD327
  • CD33L2
  • CD33LCDW327
  • CDw327
  • OB-BP1
  • Obesity-binding protein 1
  • sialic acid binding Ig-like lectin 6
  • sialic acid-binding Ig-like lectin 6
  • Siglec6
  • Siglec-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
AF1668
Species: Hu
Applications: WB, IP
AF1072
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF842
Species: Hu
Applications: WB
AF856
Species: Mu
Applications: WB, Flow, CyTOF-ready, Neut
AF165
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Siglec-6/CD327 Recombinant Protein (H00000946-P01) (0)

There are no publications for Siglec-6/CD327 Recombinant Protein (H00000946-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Siglec-6/CD327 Recombinant Protein (H00000946-P01) (0)

There are no reviews for Siglec-6/CD327 Recombinant Protein (H00000946-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Siglec-6/CD327 Recombinant Protein (H00000946-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Siglec-6/CD327 Products

Bioinformatics Tool for Siglec-6/CD327 Recombinant Protein (H00000946-P01)

Discover related pathways, diseases and genes to Siglec-6/CD327 Recombinant Protein (H00000946-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Siglec-6/CD327 Recombinant Protein (H00000946-P01)

Discover more about diseases related to Siglec-6/CD327 Recombinant Protein (H00000946-P01).
 

Pathways for Siglec-6/CD327 Recombinant Protein (H00000946-P01)

View related products by pathway.

PTMs for Siglec-6/CD327 Recombinant Protein (H00000946-P01)

Learn more about PTMs related to Siglec-6/CD327 Recombinant Protein (H00000946-P01).

Blogs on Siglec-6/CD327

There are no specific blogs for Siglec-6/CD327, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Siglec-6/CD327 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SIGLEC6
Entrez