Siglec-3/CD33 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Siglec-3/CD33 Antibody [NBP2-57539] - Human tonsil was stained for CD33+ cells (red) and counter stained with DAPI ( blue). This image was submitted via customer Review.
Immunocytochemistry/ Immunofluorescence: Siglec-3/CD33 Antibody [NBP2-57539] - Staining of human cell line PC-3 shows localization to nucleus & plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Siglec-3/CD33 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
Specificity
Specificity of human Siglec-3/CD33 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD33
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Siglec-3/CD33 Recombinant Protein Antigen (NBP2-57539PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP2-57539 in the following application:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Siglec-3/CD33 Antibody

  • CD33 antigen (gp67)
  • CD33 antigen
  • CD33 molecule
  • CD33
  • FLJ00391
  • gp67
  • myeloid cell surface antigen CD33
  • p67
  • sialic acid binding Ig-like lectin 3
  • Sialic acid-binding Ig-like lectin 3
  • Siglec3
  • Siglec-3
  • SIGLEC3gp67

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-66200
Species: Hu
AF7579
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
MAB1904
Species: Hu
Applications: WB, IHC, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1182
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57539
Species: Hu
Applications: ICC/IF

Publications for Siglec-3/CD33 Antibody (NBP2-57539) (0)

There are no publications for Siglec-3/CD33 Antibody (NBP2-57539).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Siglec-3/CD33 Antibody (NBP2-57539) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-57539:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Siglec-3/CD33 NBP2-57539
Enlarge
reviewed by:
Jan Martinek
ICC Human 06/22/2017
View

Summary

ApplicationImmunocytochemistry
Sample TestedHuman Tonsil tissue
SpeciesHuman
LotR91397

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Siglec-3/CD33 Antibody (NBP2-57539) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Siglec-3/CD33 Antibody (NBP2-57539)

Discover related pathways, diseases and genes to Siglec-3/CD33 Antibody (NBP2-57539). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Siglec-3/CD33 Antibody (NBP2-57539)

Discover more about diseases related to Siglec-3/CD33 Antibody (NBP2-57539).
 

Pathways for Siglec-3/CD33 Antibody (NBP2-57539)

View related products by pathway.

PTMs for Siglec-3/CD33 Antibody (NBP2-57539)

Learn more about PTMs related to Siglec-3/CD33 Antibody (NBP2-57539).
 

Research Areas for Siglec-3/CD33 Antibody (NBP2-57539)

Find related products by research area.

Blogs on Siglec-3/CD33

There are no specific blogs for Siglec-3/CD33, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Jan Martinek
06/22/2017
Application: ICC
Species: Human

Bioinformatics

Gene Symbol CD33
Entrez