Siglec-2/CD22 Antibody


Western Blot: CD22 Antibody [NBP1-68987] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related Siglec-2/CD22 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Siglec-2/CD22 Antibody Summary

Synthetic peptides corresponding to CD22 (CD22 molecule) The peptide sequence was selected from the C terminal of CD22. Peptide sequence YSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENVDYVIL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CD22 and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Siglec-2/CD22 Antibody

  • B-cell receptor CD22
  • BL-CAM
  • B-lymphocyte cell adhesion molecule
  • CD22 antigenMGC130020
  • CD22 molecule
  • CD22
  • sialic acid binding Ig-like lectin 2
  • Sialic acid-binding Ig-like lectin 2
  • Siglec2
  • Siglec-2
  • SIGLEC2FLJ22814
  • T-cell surface antigen Leu-14


CD22 mediates B-cell B-cell interactions. CD22 may be involved in the localization of B-cells in lymphoid tissues. CD22 binds sialylated glycoproteins; one of which is CD45. CD22 preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response CD22 seems to be involved in regulation of B-cell antigen receptor signaling. CD22 plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Block, ICC
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, B/N, Flow, IHC, IHC-Fr
Species: Hu
Applications: WB

Publications for Siglec-2/CD22 Antibody (NBP1-68987) (0)

There are no publications for Siglec-2/CD22 Antibody (NBP1-68987).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Siglec-2/CD22 Antibody (NBP1-68987) (0)

There are no reviews for Siglec-2/CD22 Antibody (NBP1-68987). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Siglec-2/CD22 Antibody (NBP1-68987). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in buying a CD22 antibody for fluorescence microscopy and FACS I red on your web page that you also offer to label your antibodies, if required, is that correct?
    • We do have the ability to perform custom conjugations on certain antibodies, including some to the CD22 protein. If you send me the conjugate you are interested in I can provide you with a quote.

Secondary Antibodies


Isotype Controls

Additional Siglec-2/CD22 Products

Bioinformatics Tool for Siglec-2/CD22 Antibody (NBP1-68987)

Discover related pathways, diseases and genes to Siglec-2/CD22 Antibody (NBP1-68987). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Siglec-2/CD22 Antibody (NBP1-68987)

Discover more about diseases related to Siglec-2/CD22 Antibody (NBP1-68987).

Pathways for Siglec-2/CD22 Antibody (NBP1-68987)

View related products by pathway.

PTMs for Siglec-2/CD22 Antibody (NBP1-68987)

Learn more about PTMs related to Siglec-2/CD22 Antibody (NBP1-68987).

Research Areas for Siglec-2/CD22 Antibody (NBP1-68987)

Find related products by research area.

Blogs on Siglec-2/CD22

There are no specific blogs for Siglec-2/CD22, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Siglec-2/CD22 Antibody and receive a gift card or discount.


Gene Symbol CD22