Shwachman Bodian-Diamond syndrome Antibody


Western Blot: Shwachman Bodian-Diamond syndrome Antibody [NBP1-55132] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.
Immunohistochemistry-Paraffin: Shwachman Bodian-Diamond syndrome Antibody [NBP1-55132] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) more

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Shwachman Bodian-Diamond syndrome Antibody Summary

Synthetic peptides corresponding to SBDS(Shwachman-Bodian-Diamond syndrome) The peptide sequence was selected from the C terminal of SBDS. Peptide sequence DYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SBDS and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Shwachman Bodian-Diamond syndrome Antibody

  • FLJ10917
  • ribosome maturation protein SBDS
  • SDSCGI-97
  • Shwachman-Bodian-Diamond syndrome protein
  • Shwachman-Bodian-Diamond syndrome
  • SWDS


SBDS is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA metabolism. Mutations within its gene are associated with Shwachman-Bodian-Diamond syndrome.This gene encodes a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The encoded protein may function in RNA metabolism. Mutations within this gene are associated with Shwachman-Bodian-Diamond syndrome. An alternative transcript has been described, but its biological nature has not been determined. This gene has a closely linked pseudogene that is distally located.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for Shwachman Bodian-Diamond syndrome Antibody (NBP1-55132) (0)

There are no publications for Shwachman Bodian-Diamond syndrome Antibody (NBP1-55132).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Shwachman Bodian-Diamond syndrome Antibody (NBP1-55132) (0)

There are no reviews for Shwachman Bodian-Diamond syndrome Antibody (NBP1-55132). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Shwachman Bodian-Diamond syndrome Antibody (NBP1-55132) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Shwachman Bodian-Diamond syndrome Products

Bioinformatics Tool for Shwachman Bodian-Diamond syndrome Antibody (NBP1-55132)

Discover related pathways, diseases and genes to Shwachman Bodian-Diamond syndrome Antibody (NBP1-55132). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Shwachman Bodian-Diamond syndrome Antibody (NBP1-55132)

Discover more about diseases related to Shwachman Bodian-Diamond syndrome Antibody (NBP1-55132).

Pathways for Shwachman Bodian-Diamond syndrome Antibody (NBP1-55132)

View related products by pathway.

PTMs for Shwachman Bodian-Diamond syndrome Antibody (NBP1-55132)

Learn more about PTMs related to Shwachman Bodian-Diamond syndrome Antibody (NBP1-55132).

Blogs on Shwachman Bodian-Diamond syndrome

There are no specific blogs for Shwachman Bodian-Diamond syndrome, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Shwachman Bodian-Diamond syndrome Antibody and receive a gift card or discount.


Gene Symbol SBDS