SH3BP2 Antibody (1E9) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related SH3BP2 Primary Antibodies

Order Details


    • Catalog Number
      H00006452-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SH3BP2 Antibody (1E9) [PerCP] Summary

Immunogen
SH3BP2 (AAH22996 452 a.a. - 561 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR
Specificity
SH3BP2 - SH3-domain binding protein 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SH3BP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SH3BP2 Antibody (1E9) [PerCP]

  • Abl-SH3 binding protein 2
  • Cherubism
  • CRBM
  • CRPM
  • FLJ42079
  • FLJ54978,3BP-2,3BP2
  • RES4-23
  • SH3 domain-binding protein 2
  • SH3-domain binding protein 2
  • TNFAIP3 interacting protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-49154
Species: Hu
Applications: IHC
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56732
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP1-92440
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00004068-M01
Species: Hu
Applications: WB, ELISA

Publications for SH3BP2 Antibody (H00006452-M01PCP) (0)

There are no publications for SH3BP2 Antibody (H00006452-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH3BP2 Antibody (H00006452-M01PCP) (0)

There are no reviews for SH3BP2 Antibody (H00006452-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SH3BP2 Antibody (H00006452-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH3BP2 Products

Bioinformatics Tool for SH3BP2 Antibody (H00006452-M01PCP)

Discover related pathways, diseases and genes to SH3BP2 Antibody (H00006452-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH3BP2 Antibody (H00006452-M01PCP)

Discover more about diseases related to SH3BP2 Antibody (H00006452-M01PCP).
 

Pathways for SH3BP2 Antibody (H00006452-M01PCP)

View related products by pathway.

PTMs for SH3BP2 Antibody (H00006452-M01PCP)

Learn more about PTMs related to SH3BP2 Antibody (H00006452-M01PCP).
 

Research Areas for SH3BP2 Antibody (H00006452-M01PCP)

Find related products by research area.

Blogs on SH3BP2

There are no specific blogs for SH3BP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH3BP2 Antibody (1E9) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol SH3BP2