SGK3 Antibody

Images

 
Western Blot: SGK3 Antibody [NBP1-58912] - Titration: 0.2-1 ug/ml, Positive Control: SH-SYSY cell lysate.
Immunohistochemistry-Paraffin: SGK3 Antibody [NBP1-58912] - Human spleen cell lysate tissue at an antibody concentration of 5 ug/ml.

Product Details

Summary
Product Discontinued
View other related SGK3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-58912
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SGK3 Antibody Summary

Immunogen
Synthetic peptides corresponding to SGK3(serum/glucocorticoid regulated kinase family, member 3) The peptide sequence was selected from the N terminal of SGK3. Peptide sequence LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SGK3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SGK3 Antibody

  • CISK
  • DKFZp781N0293
  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine-protein kinase Sgk3
  • serum/glucocorticoid regulated kinase 3
  • serum/glucocorticoid regulated kinase family, member 3
  • serum/glucocorticoid regulated kinase-like
  • Serum/glucocorticoid-regulated kinase 3
  • Serum/glucocorticoid-regulated kinase-like
  • SGK2
  • SGKLcytokine-independent survival kinase

Background

The specific function of the protein remains unknown.This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67755
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NB110-81529
Species: Hu, Mu, Rt, Po, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IP, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NB100-55408
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-62651
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46411
Species: Hu
Applications: WB, IHC
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PEP-ELISA
NBP1-58912
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P

Publications for SGK3 Antibody (NBP1-58912) (0)

There are no publications for SGK3 Antibody (NBP1-58912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SGK3 Antibody (NBP1-58912) (0)

There are no reviews for SGK3 Antibody (NBP1-58912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SGK3 Antibody (NBP1-58912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SGK3 Products

Bioinformatics Tool for SGK3 Antibody (NBP1-58912)

Discover related pathways, diseases and genes to SGK3 Antibody (NBP1-58912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SGK3 Antibody (NBP1-58912)

Discover more about diseases related to SGK3 Antibody (NBP1-58912).
 

Pathways for SGK3 Antibody (NBP1-58912)

View related products by pathway.

PTMs for SGK3 Antibody (NBP1-58912)

Learn more about PTMs related to SGK3 Antibody (NBP1-58912).
 

Research Areas for SGK3 Antibody (NBP1-58912)

Find related products by research area.

Blogs on SGK3.

mTOR Signaling and the Tumor Microenvironment
By Yoskaly Lazo-Fernandez, PhD The mammalian target of rapamycin (mTOR) is a conserved serine/threonine kinase that, as a member of two distinct intracellular protein complexes, mTORC1 and mTORC2, regulates protein...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SGK3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SGK3