SGK1 Antibody (1C4)

Images

 
Immunocytochemistry/ Immunofluorescence: SGK Antibody (1C4) [H00006446-M03] - Analysis of monoclonal antibody to SGK1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: SGK Antibody (1C4) [H00006446-M03] - Analysis of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
ELISA: SGK Antibody (1C4) [H00006446-M03] - Detection limit for recombinant GST tagged SGK is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SGK1 Antibody (1C4) Summary

Immunogen
SGK (AAH01263, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSN
Localization
Cytoplasmic and Nuclear (on phosphorylation).
Specificity
SGK - serum/glucocorticoid regulated kinase
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SGK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SGK1 Antibody (1C4)

  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine protein kinase SGK
  • serine/threonine-protein kinase Sgk1
  • serum/glucocorticoid regulated kinase 1
  • serum/glucocorticoid regulated kinase
  • Serum/glucocorticoid-regulated kinase 1
  • SGK
  • SGK1

Background

This gene encodes a serine/threonine protein kinase that is highly similar to the rat serum-and glucocorticoid-induced protein kinase (SGK). This gene was identified in a screen of hepatocellular genes regulated in response to cellular hydration or swelling. Cellular hydration is a catabolic signal, stimulating glycogenolysis and proteolysis, and inhibiting protein and glycogen synthesis. This kinase has been shown to be important in activating certain potassium, sodium, and chloride channels. Expression of this gene in hepatocytes is stimulated by transforming growth factor-beta (TGF-beta) which participates in the pathophysiology of diabetic complications. Since both TGF-beta expression and SGK expression are elevated in diabetic nephropathy, this suggests an involvement of SGK in the development of this condition.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS7240
Species: Hu, Mu, Rt, Bt, Ca, Ha
Applications: IHC-P
NBP1-54974
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP1-86102
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-82874
Species: Hu
Applications: IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP

Publications for SGK1 Antibody (H00006446-M03) (0)

There are no publications for SGK1 Antibody (H00006446-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SGK1 Antibody (H00006446-M03) (0)

There are no reviews for SGK1 Antibody (H00006446-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SGK1 Antibody (H00006446-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SGK1 Products

Bioinformatics Tool for SGK1 Antibody (H00006446-M03)

Discover related pathways, diseases and genes to SGK1 Antibody (H00006446-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SGK1 Antibody (H00006446-M03)

Discover more about diseases related to SGK1 Antibody (H00006446-M03).
 

Pathways for SGK1 Antibody (H00006446-M03)

View related products by pathway.

PTMs for SGK1 Antibody (H00006446-M03)

Learn more about PTMs related to SGK1 Antibody (H00006446-M03).
 

Research Areas for SGK1 Antibody (H00006446-M03)

Find related products by research area.

Blogs on SGK1

There are no specific blogs for SGK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SGK1 Antibody (1C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol SGK1
Entrez
OMIM
Uniprot