SFRS3 Antibody (2D2) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related SFRS3 Primary Antibodies

Order Details


    • Catalog Number
      H00006428-M08PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SFRS3 Antibody (2D2) [PE] Summary

Immunogen
SFRS3 (NP_003008, 1 a.a. - 85 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEK
Specificity
SFRS3 (2D2)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SRSF3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SFRS3 Antibody (2D2) [PE]

  • Pre-mRNA-splicing factor SRP20
  • serine/arginine-rich splicing factor 3
  • SFRS3splicing factor, arginine/serine-rich, 20-kD
  • Splicing factor, arginine/serine-rich 3SRP20
  • SRp20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NBP2-04142
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-04144
Species: Hu
Applications: WB, IHC-P, IP
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-87993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006428-M08PE
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for SFRS3 Antibody (H00006428-M08PE) (0)

There are no publications for SFRS3 Antibody (H00006428-M08PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFRS3 Antibody (H00006428-M08PE) (0)

There are no reviews for SFRS3 Antibody (H00006428-M08PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SFRS3 Antibody (H00006428-M08PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SFRS3 Products

Bioinformatics Tool for SFRS3 Antibody (H00006428-M08PE)

Discover related pathways, diseases and genes to SFRS3 Antibody (H00006428-M08PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SFRS3 Antibody (H00006428-M08PE)

Discover more about diseases related to SFRS3 Antibody (H00006428-M08PE).
 

Pathways for SFRS3 Antibody (H00006428-M08PE)

View related products by pathway.

PTMs for SFRS3 Antibody (H00006428-M08PE)

Learn more about PTMs related to SFRS3 Antibody (H00006428-M08PE).

Blogs on SFRS3

There are no specific blogs for SFRS3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFRS3 Antibody (2D2) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol SRSF3