SFPQ Antibody (6D7) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related SFPQ Primary Antibodies

Order Details


    • Catalog Number
      H00006421-M02PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SFPQ Antibody (6D7) [PE] Summary

Immunogen
SFPQ (NP_005057 269 a.a. - 361 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ
Localization
Nuclear
Specificity
SFPQ - splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SFPQ
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SFPQ Antibody (6D7) [PE]

  • 100 kDa DNA-pairing protein
  • DNA-binding p52/p100 complex, 100 kDa subunit
  • hPOMp100
  • polypyrimidine tract binding protein associated
  • polypyrimidine tract-binding protein-associated splicing factor
  • Polypyrimidine tract-binding protein-associated-splicing factor
  • PSFPOMP100
  • PTB-associated splicing factor
  • PTB-associated-splicing factor
  • splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated)
  • splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated)
  • splicing factor proline/glutamine-rich
  • splicing factor, proline- and glutamine-rich

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02060
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83801
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
AF5540
Species: Mu
Applications: WB
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC

Publications for SFPQ Antibody (H00006421-M02PE) (0)

There are no publications for SFPQ Antibody (H00006421-M02PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFPQ Antibody (H00006421-M02PE) (0)

There are no reviews for SFPQ Antibody (H00006421-M02PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SFPQ Antibody (H00006421-M02PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SFPQ Products

Bioinformatics Tool for SFPQ Antibody (H00006421-M02PE)

Discover related pathways, diseases and genes to SFPQ Antibody (H00006421-M02PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SFPQ Antibody (H00006421-M02PE)

Discover more about diseases related to SFPQ Antibody (H00006421-M02PE).
 

Pathways for SFPQ Antibody (H00006421-M02PE)

View related products by pathway.

PTMs for SFPQ Antibody (H00006421-M02PE)

Learn more about PTMs related to SFPQ Antibody (H00006421-M02PE).
 

Research Areas for SFPQ Antibody (H00006421-M02PE)

Find related products by research area.

Blogs on SFPQ

There are no specific blogs for SFPQ, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFPQ Antibody (6D7) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol SFPQ