SFMBT1 Antibody

Images

 
Immunohistochemistry-Paraffin: SFMBT1 Antibody [NBP1-84181] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts, Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SFMBT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQPPSAIRHLKNEAEWQEILAKVKEEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SFMBT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SFMBT1 Protein (NBP1-84181PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SFMBT1 Antibody

  • DKFZp434L243
  • Renal ubiquitous protein 1
  • RU1scm-like with four MBT domains protein 1
  • Scm-like with four mbt domains 1
  • Scm-related gene containing four mbt domains
  • Scm-related gene product containing four mbt domains
  • SFMBT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2806
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB600-488
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33470
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00060485-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-07996
Species: Hu
NBP2-38230
Species: Hu
Applications: IHC, IHC-P
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84181
Species: Hu
Applications: IHC, IHC-P

Publications for SFMBT1 Antibody (NBP1-84181) (0)

There are no publications for SFMBT1 Antibody (NBP1-84181).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFMBT1 Antibody (NBP1-84181) (0)

There are no reviews for SFMBT1 Antibody (NBP1-84181). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SFMBT1 Antibody (NBP1-84181) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SFMBT1 Products

Bioinformatics Tool for SFMBT1 Antibody (NBP1-84181)

Discover related pathways, diseases and genes to SFMBT1 Antibody (NBP1-84181). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SFMBT1 Antibody (NBP1-84181)

Discover more about diseases related to SFMBT1 Antibody (NBP1-84181).
 

Pathways for SFMBT1 Antibody (NBP1-84181)

View related products by pathway.

Blogs on SFMBT1

There are no specific blogs for SFMBT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFMBT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SFMBT1