SF3A2 Antibody (3B6) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related SF3A2 Primary Antibodies

Order Details


    • Catalog Number
      H00008175-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SF3A2 Antibody (3B6) [PerCP] Summary

Immunogen
SF3A2 (NP_009096 112 a.a. - 216 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEK
Specificity
SF3A2 (3B6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SF3A2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SF3A2 Antibody (3B6) [PerCP]

  • pre-mRNA splicing factor SF3A, subunit 2
  • PRP11
  • PRPF11
  • SAP 62
  • SAP62Prp11
  • SF3a66splicing factor 3a, subunit 2, 66kD
  • spliceosome associated protein 62
  • Spliceosome-associated protein 62
  • splicing factor 3A subunit 2
  • splicing factor 3a, subunit 2, 66kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87212
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-79843
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-86966
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91949
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-79848
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-83565
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82623
Species: Hu
Applications: IHC, IHC-P
NBP1-74190
Species: Mu
Applications: WB, ChIP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP

Publications for SF3A2 Antibody (H00008175-M01PCP) (0)

There are no publications for SF3A2 Antibody (H00008175-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SF3A2 Antibody (H00008175-M01PCP) (0)

There are no reviews for SF3A2 Antibody (H00008175-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SF3A2 Antibody (H00008175-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SF3A2 Products

SF3A2 H00008175-M01PCP

Bioinformatics Tool for SF3A2 Antibody (H00008175-M01PCP)

Discover related pathways, diseases and genes to SF3A2 Antibody (H00008175-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SF3A2 Antibody (H00008175-M01PCP)

Discover more about diseases related to SF3A2 Antibody (H00008175-M01PCP).
 

Pathways for SF3A2 Antibody (H00008175-M01PCP)

View related products by pathway.

Blogs on SF3A2

There are no specific blogs for SF3A2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SF3A2 Antibody (3B6) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol SF3A2