SETDB2 Antibody


Western Blot: SETDB2 Antibody [NBP1-52992] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related SETDB2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SETDB2 Antibody Summary

Synthetic peptides corresponding to SETDB2(SET domain, bifurcated 2) The peptide sequence was selected from the N terminal of SETDB2. Peptide sequence ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SETDB2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SETDB2 Antibody

  • C13orf4
  • chromosome 13 open reading frame 4
  • chronic lymphocytic leukemia deletion region 8
  • Chronic lymphocytic leukemia deletion region gene 8 protein
  • CLLD8DKFZp761J1217
  • DKFZp586I0123
  • EC
  • histone-lysine N-methyltransferase SETDB2
  • Lysine N-methyltransferase 1F
  • SET domain bifurcated 2
  • SET domain, bifurcated 2


Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, IP, ChIP, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB

Publications for SETDB2 Antibody (NBP1-52992) (0)

There are no publications for SETDB2 Antibody (NBP1-52992).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SETDB2 Antibody (NBP1-52992) (0)

There are no reviews for SETDB2 Antibody (NBP1-52992). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SETDB2 Antibody (NBP1-52992) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SETDB2 Products

Bioinformatics Tool for SETDB2 Antibody (NBP1-52992)

Discover related pathways, diseases and genes to SETDB2 Antibody (NBP1-52992). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SETDB2 Antibody (NBP1-52992)

Discover more about diseases related to SETDB2 Antibody (NBP1-52992).

Pathways for SETDB2 Antibody (NBP1-52992)

View related products by pathway.

PTMs for SETDB2 Antibody (NBP1-52992)

Learn more about PTMs related to SETDB2 Antibody (NBP1-52992).

Blogs on SETDB2

There are no specific blogs for SETDB2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SETDB2 Antibody and receive a gift card or discount.


Gene Symbol SETDB2