SETD7 Antibody

Images

 
Western Blot: SETD7 Antibody [NBP1-52991] - Human Pancrease lysate, concentration 5.0ug/ml.

Product Details

Summary
Product Discontinued
View other related SETD7 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52991
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SETD7 Antibody Summary

Immunogen
Synthetic peptides corresponding to SETD7(SET domain containing (lysine methyltransferase) 7) The peptide sequence was selected from the C terminal of SETD7. Peptide sequence PRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF.
Clonality
Polyclonal
Host
Rabbit
Gene
SETD7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SETD7 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SETD7 Antibody

  • EC 2.1.1.43
  • H3-K4-HMTase SETD7
  • histone H3-lysine 4-specific methyltransferase
  • histone-lysine N-methyltransferase SETD7
  • KIAA1717SET domain-containing protein 7
  • KMT7FLJ21193
  • Lysine N-methyltransferase 7
  • SET domain containing (lysine methyltransferase) 7
  • SET7/9Histone H3-K4 methyltransferase SETD7
  • SET7Set9
  • SET9

Background

SETD7 is a histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. It plays a central role in the transcriptional activation of genes such as collagenase or insulin. It is recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. It has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-91269
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB600-248
Species: Hu
Applications: WB, IP
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP2-17086
Species: Hu, Mu, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-06640
Species: Hu, Mu
Applications: WB, Flow, ICC/IF

Publications for SETD7 Antibody (NBP1-52991) (0)

There are no publications for SETD7 Antibody (NBP1-52991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SETD7 Antibody (NBP1-52991) (0)

There are no reviews for SETD7 Antibody (NBP1-52991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SETD7 Antibody (NBP1-52991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SETD7 Products

Bioinformatics Tool for SETD7 Antibody (NBP1-52991)

Discover related pathways, diseases and genes to SETD7 Antibody (NBP1-52991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SETD7 Antibody (NBP1-52991)

Discover more about diseases related to SETD7 Antibody (NBP1-52991).
 

Pathways for SETD7 Antibody (NBP1-52991)

View related products by pathway.

PTMs for SETD7 Antibody (NBP1-52991)

Learn more about PTMs related to SETD7 Antibody (NBP1-52991).

Blogs on SETD7

There are no specific blogs for SETD7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SETD7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SETD7
Uniprot