SET Antibody (M1-F5) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related SET Primary Antibodies

Order Details


    • Catalog Number
      H00006418-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SET Antibody (M1-F5) [PerCP] Summary

Immunogen
SET (AAH32749.1, 1 a.a. - 277 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD
Specificity
SET - SET translocation (myeloid leukemia-associated)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SET
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SET Antibody (M1-F5) [PerCP]

  • 2PP2A
  • HLA-DR-associated protein II
  • I2PP2A
  • I-2PP2A
  • IGAAD
  • Inhibitor of granzyme A-activated DNase
  • inhibitor-2 of protein phosphatase-2A
  • IPP2A2
  • PHAPIITAF-I
  • Phosphatase 2A inhibitor I2PP2A
  • protein phosphatase type 2A inhibitor
  • protein SET
  • SET nuclear oncogene
  • SET translocation (myeloid leukemia-associated)
  • TAF-IBETA
  • Template-activating factor I
  • Template-Activating Factor-I, chromatin remodelling factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15412
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-2244
Species: Hu
Applications: WB, ICC/IF, IHC-P, IP
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP1-69801
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IF
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
AF7250
Species: Hu
Applications: IHC
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for SET Antibody (H00006418-M01PCP) (0)

There are no publications for SET Antibody (H00006418-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SET Antibody (H00006418-M01PCP) (0)

There are no reviews for SET Antibody (H00006418-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SET Antibody (H00006418-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SET Products

Bioinformatics Tool for SET Antibody (H00006418-M01PCP)

Discover related pathways, diseases and genes to SET Antibody (H00006418-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SET Antibody (H00006418-M01PCP)

Discover more about diseases related to SET Antibody (H00006418-M01PCP).
 

Pathways for SET Antibody (H00006418-M01PCP)

View related products by pathway.

PTMs for SET Antibody (H00006418-M01PCP)

Learn more about PTMs related to SET Antibody (H00006418-M01PCP).
 

Research Areas for SET Antibody (H00006418-M01PCP)

Find related products by research area.

Blogs on SET

There are no specific blogs for SET, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SET Antibody (M1-F5) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol SET