SESN2 Antibody

Images

 
Western Blot: SESN2 Antibody [NBP1-79853] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related SESN2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-79853
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SESN2 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human SESN2The immunogen for this antibody is SESN2. Peptide sequence LKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESL.
Clonality
Polyclonal
Host
Rabbit
Gene
SESN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against SESN2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SESN2 Antibody

  • DKFZp761M0212
  • DKFZp761M02121
  • Hi95
  • HI95sestrin-2
  • SES2
  • SEST2hypoxia induced gene 95
  • sestrin 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00027244-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP1-36991
Species: Hu
Applications: WB, PEP-ELISA
NBP1-57739
Species: Hu
Applications: WB
NBP1-32822
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP1-77321
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-87861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56398
Species: Hu
Applications: WB, ICC/IF
NBP2-46085
Species: Hu
Applications: WB, IHC
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-239
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-79853
Species: Hu
Applications: WB

Publications for SESN2 Antibody (NBP1-79853) (0)

There are no publications for SESN2 Antibody (NBP1-79853).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SESN2 Antibody (NBP1-79853) (0)

There are no reviews for SESN2 Antibody (NBP1-79853). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SESN2 Antibody (NBP1-79853) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SESN2 Antibody (NBP1-79853)

Discover related pathways, diseases and genes to SESN2 Antibody (NBP1-79853). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SESN2 Antibody (NBP1-79853)

Discover more about diseases related to SESN2 Antibody (NBP1-79853).
 

Pathways for SESN2 Antibody (NBP1-79853)

View related products by pathway.

PTMs for SESN2 Antibody (NBP1-79853)

Learn more about PTMs related to SESN2 Antibody (NBP1-79853).
 

Research Areas for SESN2 Antibody (NBP1-79853)

Find related products by research area.

Blogs on SESN2

There are no specific blogs for SESN2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SESN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SESN2
Uniprot