Seryl tRNA synthetase Antibody (1H4) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related Seryl tRNA synthetase Primary Antibodies

Order Details


    • Catalog Number
      H00006301-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Seryl tRNA synthetase Antibody (1H4) [PerCP] Summary

Immunogen
SARS (AAH00716, 1 a.a. - 514 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA
Specificity
SARS - seryl-tRNA synthetase
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SARS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Seryl tRNA synthetase Antibody (1H4) [PerCP]

  • EC 6.1.1.11
  • FLJ36399
  • serine-tRNA ligase
  • Serine--tRNA ligase
  • SERRS
  • SERSserine tRNA ligase 1, cytoplasmic
  • Seryl-tRNA Ser/Sec synthetase
  • seryl-tRNA synthetase
  • seryl-tRNA synthetase, cytoplasmic
  • Seryl-tRNA(Ser/Sec) synthetase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03256
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1481
Species: Hu
Applications: WB, PEP-ELISA
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57521
Species: Hu
Applications: ICC/IF
AF2275
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00007024-B01P
Species: Hu, Mu, Rt
Applications: WB

Publications for Seryl tRNA synthetase Antibody (H00006301-M01PCP) (0)

There are no publications for Seryl tRNA synthetase Antibody (H00006301-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Seryl tRNA synthetase Antibody (H00006301-M01PCP) (0)

There are no reviews for Seryl tRNA synthetase Antibody (H00006301-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Seryl tRNA synthetase Antibody (H00006301-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Seryl tRNA synthetase Products

Bioinformatics Tool for Seryl tRNA synthetase Antibody (H00006301-M01PCP)

Discover related pathways, diseases and genes to Seryl tRNA synthetase Antibody (H00006301-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Seryl tRNA synthetase Antibody (H00006301-M01PCP)

Discover more about diseases related to Seryl tRNA synthetase Antibody (H00006301-M01PCP).
 

Pathways for Seryl tRNA synthetase Antibody (H00006301-M01PCP)

View related products by pathway.

PTMs for Seryl tRNA synthetase Antibody (H00006301-M01PCP)

Learn more about PTMs related to Seryl tRNA synthetase Antibody (H00006301-M01PCP).
 

Research Areas for Seryl tRNA synthetase Antibody (H00006301-M01PCP)

Find related products by research area.

Blogs on Seryl tRNA synthetase

There are no specific blogs for Seryl tRNA synthetase, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Seryl tRNA synthetase Antibody (1H4) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol SARS