Serum Response Factor SRF Antibody (2G2) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related Serum Response Factor SRF Primary Antibodies

Order Details


    • Catalog Number
      H00006722-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Serum Response Factor SRF Antibody (2G2) [PE] Summary

Immunogen
SRF (AAH48211 406 a.a. - 508 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHSTKSE
Specificity
SRF - serum response factor (c-fos serum response element-binding transcription factor)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SRF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Serum Response Factor SRF Antibody (2G2) [PE]

  • MCM1
  • serum response factor (c-fos serum response element-binding transcriptionfactor)
  • serum response factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4028
Species: Hu, Mu
Applications: WB
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
PPS021
Species: Hu, Mu, Rt, Ca, Pm, Ze
Applications: WB
H00023415-R03
Species: Hu
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006722-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Serum Response Factor SRF Antibody (H00006722-M01PE) (0)

There are no publications for Serum Response Factor SRF Antibody (H00006722-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serum Response Factor SRF Antibody (H00006722-M01PE) (0)

There are no reviews for Serum Response Factor SRF Antibody (H00006722-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Serum Response Factor SRF Antibody (H00006722-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serum Response Factor SRF Products

Bioinformatics Tool for Serum Response Factor SRF Antibody (H00006722-M01PE)

Discover related pathways, diseases and genes to Serum Response Factor SRF Antibody (H00006722-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serum Response Factor SRF Antibody (H00006722-M01PE)

Discover more about diseases related to Serum Response Factor SRF Antibody (H00006722-M01PE).
 

Pathways for Serum Response Factor SRF Antibody (H00006722-M01PE)

View related products by pathway.

PTMs for Serum Response Factor SRF Antibody (H00006722-M01PE)

Learn more about PTMs related to Serum Response Factor SRF Antibody (H00006722-M01PE).
 

Research Areas for Serum Response Factor SRF Antibody (H00006722-M01PE)

Find related products by research area.

Blogs on Serum Response Factor SRF

There are no specific blogs for Serum Response Factor SRF, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serum Response Factor SRF Antibody (2G2) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol SRF