Recombinant Human Serum Amyloid A1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Serum Amyloid A1 Peptides and Proteins

Order Details


    • Catalog Number
      H00006288-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Serum Amyloid A1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-122 of Human SAA1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
SAA1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Serum Amyloid A1 Protein

  • MGC111216
  • PIG4
  • SAA
  • SAA1
  • SAA2
  • serum amyloid A protein
  • Serum Amyloid A1
  • TP53I4
  • tumor protein p53 inducible protein 4

Background

SAA1( AAH07022, 1 a.a. - 123 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
AF3856
Species: Hu
Applications: WB, IHC
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF4409
Species: Mu
Applications: WB
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for Serum Amyloid A1 Recombinant Protein (H00006288-P01) (0)

There are no publications for Serum Amyloid A1 Recombinant Protein (H00006288-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serum Amyloid A1 Recombinant Protein (H00006288-P01) (0)

There are no reviews for Serum Amyloid A1 Recombinant Protein (H00006288-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serum Amyloid A1 Recombinant Protein (H00006288-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Serum Amyloid A1 Products

Bioinformatics Tool for Serum Amyloid A1 Recombinant Protein (H00006288-P01)

Discover related pathways, diseases and genes to Serum Amyloid A1 Recombinant Protein (H00006288-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serum Amyloid A1 Recombinant Protein (H00006288-P01)

Discover more about diseases related to Serum Amyloid A1 Recombinant Protein (H00006288-P01).
 

Pathways for Serum Amyloid A1 Recombinant Protein (H00006288-P01)

View related products by pathway.

PTMs for Serum Amyloid A1 Recombinant Protein (H00006288-P01)

Learn more about PTMs related to Serum Amyloid A1 Recombinant Protein (H00006288-P01).
 

Research Areas for Serum Amyloid A1 Recombinant Protein (H00006288-P01)

Find related products by research area.

Blogs on Serum Amyloid A1

There are no specific blogs for Serum Amyloid A1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Serum Amyloid A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SAA1
Entrez