![Western Blot: SERPINB11 Antibody [NBP2-84258] - Host: Rabbit. Target Name: SERPINB11. Sample Tissue: Mouse Pancreas lysates. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize2/SERPINB11-Antibody-Western-Blot-NBP2-84258-img0001.jpg "Western Blot: SERPINB11 Antibody [NBP2-84258] - Host: Rabbit. Target Name: SERPINB11. Sample Tissue: Mouse Pancreas lysates. Antibody Dilution: 1ug/ml")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse SERPINB11. Peptide sequence: LGMRDIFNVANADLSGMSPDKGLYLSKVVHKSYVDVNEEGTEAAAATGES The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SERPINB11 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot: SERPINB12 Antibody [NB100-93572] - Western blot analysis of 3 ug of recombinant SERPINB12 using NB100-93572 at 1:1000 dilution](http://images.novusbio.com/images2/SERPINB12-Antibody-Western-Blot-NB100-93572-img0001.jpg)
![Western Blot: SERPINB4 Antibody (4C8) [NBP2-03595] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SERPINB4 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SERPINB4.](http://images.novusbio.com/images/SERPINB4-Antibody-(4C8)-Western-Blot-NBP2-03595-img0001.jpg)
![Immunohistochemistry-Paraffin: SERPINB4 Antibody (4C8) [NBP2-03595] - Staining of paraffin-embedded Carcinoma of Human pancreas tissue using anti-SERPINB4 mouse monoclonal antibody.](http://images.novusbio.com/images/SERPINB4-Antibody-(4C8)-Immunohistochemistry-Paraffin-NBP2-03595-img0002.jpg)
![Immunohistochemistry-Paraffin: SERPINB4 Antibody (4C8) [NBP2-03595] Staining of paraffin-embedded Human liver tissue using anti-SERPINB4 mouse monoclonal antibody.](http://images.novusbio.com/images/SERPINB4-Antibody-(4C8)-Immunohistochemistry-Paraffin-NBP2-03595-img0003.jpg)
![Western Blot: Serpin B5/Maspin Antibody [NBP1-87780] - Analysis in human cell lines PC-3 and Caco-2 using anti-SERPINB5 antibody. Corresponding SERPINB5 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.](http://images.novusbio.com/images2/Serpin-B5-Maspin-Antibody-Western-Blot-NBP1-87780-img0010.jpg)
![Western Blot: Serpin B5/Maspin Antibody [NBP1-87780] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/images2/Serpin-B5-Maspin-Antibody-Western-Blot-NBP1-87780-img0011.jpg)
![Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780] - Staining of human cerebral cortex, liver, skin and testis using Anti-SERPINB5 antibody NBP1-87780 (A) shows similar protein distribution across tissues to independent antibody NBP1-87779 (B).](http://images.novusbio.com/images2/Serpin-B5-Maspin-Antibody-Immunohistochemistry-Paraffin-NBP1-87780-img0012.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for SERPINB11 Antibody (NBP2-84258)Discover more about diseases related to SERPINB11 Antibody (NBP2-84258).
| Pathways for SERPINB11 Antibody (NBP2-84258)View related products by pathway.
|
PTMs for SERPINB11 Antibody (NBP2-84258)Learn more about PTMs related to SERPINB11 Antibody (NBP2-84258).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SERPINB11 |
![Immunohistochemistry-Paraffin: SerpinB7 Antibody [NBP1-82782] - Staining of human kidney shows low expression as expected.](http://images.novusbio.com/images2/SerpinB7-Antibody-Immunohistochemistry-Paraffin-NBP1-82782-img0002.jpg)
![Immunohistochemistry-Paraffin: SerpinB7 Antibody [NBP1-82782] - Staining of human skin shows high expression.](http://images.novusbio.com/images2/SerpinB7-Antibody-Immunohistochemistry-Paraffin-NBP1-82782-img0003.jpg)
![Immunohistochemistry-Paraffin: SerpinB7 Antibody [NBP1-82782] - Staining in human skin and kidney tissues using anti-SERPINB7 antibody. Corresponding SERPINB7 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/SerpinB7-Antibody-Immunohistochemistry-Paraffin-NBP1-82782-img0004.jpg)
![Western Blot: Ovalbumin Antibody [NB600-922] - Analysis using the HRP conjugate of NB600-922. Detection of Lane 1: Ovalbumin (Hen Egg). Load: 50 ng per lane. Dilution: 1:1,000. Predicted/Observed size: 43 kDa, 43 kDa for Ovalbumin. Other band(s): Ovalbumin splice variants and isoforms.](http://images.novusbio.com/images2/Ovalbumin-Antibody-Western-Blot-NB600-922-img0009.jpg)
![Western Blot: Ovalbumin Antibody [NB600-922] - Analysis using the HRP conjugate of NB600-922. Detection of Lane 1: Ovalbumin. Load: 50 ng per lane. Dilution: 1:1,000. Predicted/Observed size: 43 kDa, 43 kDa for Ovalbumin. Other band(s): Ovalbumin splice variants and isoforms.](http://images.novusbio.com/images2/Ovalbumin-Antibody-Western-Blot-NB600-922-img0010.jpg)
![Western Blot: Ovalbumin Antibody [NB600-922] - Analysis using the HRP conjugate of NB600-922. Detection of purified egg white proteins (lysozyme, ovalbumin, ovotransferrin). Image from verified customer review.](http://images.novusbio.com/images2/Ovalbumin-Antibody-Western-Blot-NB600-922-img0011.jpg)
![Immunohistochemistry: Serpin B3/SCCA1 Antibody (1A12) [NBP2-45788] - Analysis of Human Kidney tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)](http://images.novusbio.com/images2/Serpin-B3-SCCA1-Antibody-(1A12)-Immunohistochemistry-NBP2-45788-img0001.jpg)
![Immunohistochemistry: Serpin B3/SCCA1 Antibody (1A12) [NBP2-45788] - Analysis of Carcinoma of Human lung tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)](http://images.novusbio.com/images2/Serpin-B3-SCCA1-Antibody-(1A12)-Immunohistochemistry-NBP2-45788-img0002.jpg)
![Immunohistochemistry: Serpin B3/SCCA1 Antibody (1A12) [NBP2-45788] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)](http://images.novusbio.com/images2/Serpin-B3-SCCA1-Antibody-(1A12)-Immunohistochemistry-NBP2-45788-img0003.jpg)
![Immunohistochemistry: SERPINB13 Antibody (OTI2B6) [NBP2-01312] - Cytoplasmic staining was detected for Serpin B13 protein in the malignant epithelium of breast cancer. The majority of 'pure' HER2+ (HER2+/ER-/PR-) tumours showed loss of SERPIN B13 staining. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41419-018-0364-9), licensed under a CC-BY licence.](http://images.novusbio.com/images2/SERPINB13-Antibody-(OTI2B6)-Immunohistochemistry-NBP2-01312-img0006.jpg)
![Western Blot: SERPINB13 Antibody (2B6) [NBP2-01312] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SERPINB13 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SERPINB13.](http://images.novusbio.com/images/SERPINB13-Antibody-(2B6)-Western-Blot-NBP2-01312-img0001.jpg)
![Immunohistochemistry-Paraffin: SERPINB13 Antibody (2B6) [NBP2-01312] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-SERPINB13 mouse monoclonal antibody.](http://images.novusbio.com/images/SERPINB13-Antibody-(2B6)-Immunohistochemistry-Paraffin-NBP2-01312-img0002.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")