Serpin D1/Heparin Cofactor II Antibody


Immunocytochemistry/ Immunofluorescence: Serpin D1/Heparin Cofactor II Antibody [NBP2-33764] - Staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry-Paraffin: Serpin D1/Heparin Cofactor II Antibody [NBP2-33764] - Staining of human colon shows distinctly stained plasma.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Serpin D1/Heparin Cofactor II Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Serpin D1/Heparin Cofactor II Protein (NBP2-33764PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Serpin D1/Heparin Cofactor II Antibody

  • HC2
  • HC2LS2
  • HCF2
  • HCF2clade D (heparin cofactor), member 1
  • HC-II
  • Heparin Cofactor II
  • leuserpin 2
  • LS2
  • Protease inhibitor leuserpin-2
  • Serpin D1
  • serpin peptidase inhibitor, clade D (heparin cofactor), member 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IP, Neut
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IP
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764) (0)

There are no publications for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764) (0)

There are no reviews for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Serpin D1/Heparin Cofactor II Products

Bioinformatics Tool for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764)

Discover related pathways, diseases and genes to Serpin D1/Heparin Cofactor II Antibody (NBP2-33764). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764)

Discover more about diseases related to Serpin D1/Heparin Cofactor II Antibody (NBP2-33764).

Pathways for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764)

View related products by pathway.

PTMs for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764)

Learn more about PTMs related to Serpin D1/Heparin Cofactor II Antibody (NBP2-33764).

Blogs on Serpin D1/Heparin Cofactor II

There are no specific blogs for Serpin D1/Heparin Cofactor II, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Serpin D1/Heparin Cofactor II Antibody and receive a gift card or discount.


Gene Symbol SERPIND1