Serpin D1/Heparin Cofactor II Antibody (NBP2-33764)

Images

 
Immunocytochemistry/ Immunofluorescence: Serpin D1/Heparin Cofactor II Antibody [NBP2-33764] - Staining of human cell line Hep G2 shows localization to vesicles.
Immunohistochemistry-Paraffin: Serpin D1/Heparin Cofactor II Antibody [NBP2-33764] - Staining of human colon shows distinctly stained plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Serpin D1/Heparin Cofactor II Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPIND1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
Serpin D1/Heparin Cofactor II Protein (NBP2-33764PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Serpin D1/Heparin Cofactor II Antibody

  • HC2
  • HC2LS2
  • HCF2
  • HCF2clade D (heparin cofactor), member 1
  • HC-II
  • Heparin Cofactor II
  • HLS2HCII
  • leuserpin 2
  • LS2
  • Protease inhibitor leuserpin-2
  • Serpin D1
  • serpin peptidase inhibitor, clade D (heparin cofactor), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1267
Species: Hu
Applications: WB, IP, Neut
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
H00000259-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00005555-P01
Species: Hu
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33764
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764) (0)

There are no publications for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764) (0)

There are no reviews for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serpin D1/Heparin Cofactor II Products

Related Products by Gene

Bioinformatics Tool for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764)

Discover related pathways, diseases and genes to Serpin D1/Heparin Cofactor II Antibody (NBP2-33764). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764)

Discover more about diseases related to Serpin D1/Heparin Cofactor II Antibody (NBP2-33764).
 

Pathways for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764)

View related products by pathway.

PTMs for Serpin D1/Heparin Cofactor II Antibody (NBP2-33764)

Learn more about PTMs related to Serpin D1/Heparin Cofactor II Antibody (NBP2-33764).

Blogs on Serpin D1/Heparin Cofactor II

There are no specific blogs for Serpin D1/Heparin Cofactor II, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin D1/Heparin Cofactor II Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPIND1
Entrez
Uniprot