Serpin C1/Antithrombin-III Antibody

Images

 
Western Blot: Antithrombin III Antibody [NBP1-74141] - Mouse Small Intestine Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Product Discontinued
View other related Serpin C1/Antithrombin-III Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74141
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Serpin C1/Antithrombin-III Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Serpinc1. Immunizing peptide sequence AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV.
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Serpinc1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Serpin C1/Antithrombin-III Antibody

  • Antithrombin-III
  • AT3antithrombin-III
  • ATIII
  • ATIIIantithrombin III
  • MGC22579
  • serine (or cysteine) proteinase inhibitor, clade C (antithrombin), member 1
  • serine-cysteine proteinase inhibitor clade C member 1
  • Serpin C1
  • serpin peptidase inhibitor, clade C (antithrombin), member 1

Background

Serpinc1 is the most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1239
Species: Mu
Applications: WB, IHC, IP
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
795-P4/CF
Species: Hu
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P

Publications for Serpin C1/Antithrombin-III Antibody (NBP1-74141) (0)

There are no publications for Serpin C1/Antithrombin-III Antibody (NBP1-74141).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin C1/Antithrombin-III Antibody (NBP1-74141) (0)

There are no reviews for Serpin C1/Antithrombin-III Antibody (NBP1-74141). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serpin C1/Antithrombin-III Antibody (NBP1-74141) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serpin C1/Antithrombin-III Products

Bioinformatics Tool for Serpin C1/Antithrombin-III Antibody (NBP1-74141)

Discover related pathways, diseases and genes to Serpin C1/Antithrombin-III Antibody (NBP1-74141). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin C1/Antithrombin-III Antibody (NBP1-74141)

Discover more about diseases related to Serpin C1/Antithrombin-III Antibody (NBP1-74141).
 

Pathways for Serpin C1/Antithrombin-III Antibody (NBP1-74141)

View related products by pathway.

PTMs for Serpin C1/Antithrombin-III Antibody (NBP1-74141)

Learn more about PTMs related to Serpin C1/Antithrombin-III Antibody (NBP1-74141).

Blogs on Serpin C1/Antithrombin-III

There are no specific blogs for Serpin C1/Antithrombin-III, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin C1/Antithrombin-III Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINC1
Entrez
Uniprot