Serpin B5/Maspin Antibody

Images

 
Western Blot: Serpin B5/Maspin Antibody [NBP1-57675] - HepG2 cell lysate, Antibody Titration: 0.625ug/ml
Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-57675] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.

Product Details

Summary
Product Discontinued
View other related Serpin B5/Maspin Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57675
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Serpin B5/Maspin Antibody Summary

Immunogen
Synthetic peptides corresponding to SERPINB5(serpin peptidase inhibitor, clade B (ovalbumin), member 5) The peptide sequence was selected from the middle region of SERPINB5. Peptide sequence NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINB5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SERPINB5 and was validated on Western Blot and immunohistochemistry-paraffin
Control
Serpin B5/Maspin Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Serpin B5/Maspin Antibody

  • Maspin
  • Peptidase inhibitor 5
  • PI5
  • PI-5
  • PI5protease inhibitor 5 (maspin)
  • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 5
  • Serpin B5
  • serpin peptidase inhibitor, clade B (ovalbumin), member 5

Background

As a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85571
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45788
Species: Hu
Applications: WB, IHC
NBP1-33188
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-922
Species: Ch
Applications: WB, ELISA, IHC, IHC-P, IP
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-03595
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IF
NBP2-78336
Species: Hu
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP1-57675
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P

Publications for Serpin B5/Maspin Antibody (NBP1-57675) (0)

There are no publications for Serpin B5/Maspin Antibody (NBP1-57675).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin B5/Maspin Antibody (NBP1-57675) (0)

There are no reviews for Serpin B5/Maspin Antibody (NBP1-57675). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serpin B5/Maspin Antibody (NBP1-57675) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Serpin B5/Maspin Products

Bioinformatics Tool for Serpin B5/Maspin Antibody (NBP1-57675)

Discover related pathways, diseases and genes to Serpin B5/Maspin Antibody (NBP1-57675). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin B5/Maspin Antibody (NBP1-57675)

Discover more about diseases related to Serpin B5/Maspin Antibody (NBP1-57675).
 

Pathways for Serpin B5/Maspin Antibody (NBP1-57675)

View related products by pathway.

PTMs for Serpin B5/Maspin Antibody (NBP1-57675)

Learn more about PTMs related to Serpin B5/Maspin Antibody (NBP1-57675).
 

Research Areas for Serpin B5/Maspin Antibody (NBP1-57675)

Find related products by research area.

Blogs on Serpin B5/Maspin

There are no specific blogs for Serpin B5/Maspin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serpin B5/Maspin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINB5
Uniprot