Recombinant Human Serpin B3/SCCA1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Serpin B3/SCCA1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 276-390 of Human Serpin B3/SCCA1

Source: Wheat Germ

Amino Acid Sequence: RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SERPINB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
38.39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00006317-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Serpin B3/SCCA1 Protein

  • HsT1196
  • Protein T4-A
  • SCC
  • SCCA
  • SCCA1
  • SCCA1SCCA-1
  • SCCA-PD
  • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3
  • Serpin B3
  • serpin peptidase inhibitor, clade B (ovalbumin), member 3
  • Squamous cell carcinoma antigen 1
  • T4-A

Background

SERPINB3 - serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-03595
Species: Hu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP2-24695
Species: Hu
Applications: WB, IHC-P
H00006317-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Serpin B3/SCCA1 Partial Recombinant Protein (H00006317-Q01)(1)

Reviews for Serpin B3/SCCA1 Partial Recombinant Protein (H00006317-Q01) (0)

There are no reviews for Serpin B3/SCCA1 Partial Recombinant Protein (H00006317-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serpin B3/SCCA1 Partial Recombinant Protein (H00006317-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Serpin B3/SCCA1 Partial Recombinant Protein (H00006317-Q01)

Discover related pathways, diseases and genes to Serpin B3/SCCA1 Partial Recombinant Protein (H00006317-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Serpin B3/SCCA1 Partial Recombinant Protein (H00006317-Q01)

Discover more about diseases related to Serpin B3/SCCA1 Partial Recombinant Protein (H00006317-Q01).
 

Pathways for Serpin B3/SCCA1 Partial Recombinant Protein (H00006317-Q01)

View related products by pathway.

PTMs for Serpin B3/SCCA1 Partial Recombinant Protein (H00006317-Q01)

Learn more about PTMs related to Serpin B3/SCCA1 Partial Recombinant Protein (H00006317-Q01).
 

Research Areas for Serpin B3/SCCA1 Partial Recombinant Protein (H00006317-Q01)

Find related products by research area.

Blogs on Serpin B3/SCCA1

There are no specific blogs for Serpin B3/SCCA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Serpin B3/SCCA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINB3
Entrez