Serotonin Antibody



Product Details

Product Discontinued
View other related Serotonin Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Serotonin Antibody Summary

Synthetic peptides corresponding to Htr3a (5-hydroxytryptamine (serotonin) receptor 3a) The peptide sequence was selected from the middle region of Htr3a. Peptide sequence PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against Htr3a and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
55 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses in neurons. It is a cation-specific, but otherwise relatively nonselective, ion channel.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Serotonin Antibody (NBP1-69077) (0)

There are no publications for Serotonin Antibody (NBP1-69077).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serotonin Antibody (NBP1-69077) (0)

There are no reviews for Serotonin Antibody (NBP1-69077). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for Serotonin Antibody (NBP1-69077) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Serotonin Antibody Products

Bioinformatics Tool for Serotonin Antibody (NBP1-69077)

Discover related pathways, diseases and genes to Serotonin Antibody (NBP1-69077). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Serotonin.

How DOPA Decarboxylase Affects Neurotransmitter Synthesis
DOPA decarboxylase (DDC) is responsible for catalyzing the conversion of aromatic amino acids into their corresponding amines during the synthesis of several important neurotransmitters. Specifically, DDC catalyzes the decarboxylation of L-DOPA to...  Read full blog post.

"Freeze!" - Arrestin Antibodies Used in New Serotonin Syndrome Study
The beta-arrestin family regulate receptor binding of G-proteins, a group of seven transmembrane receptor proteins which includes the adrenergic, dopamine and serotonin receptors. Recently, arrestin antibodies were used in a study into Serotonin Syndr...  Read full blog post.

Contact Information

Product PDFs


Gene Symbol Htr3a

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69077 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.