Serotonin Antibody

Images

 
Western Blot: Serotonin Antibody [NBP1-69077] - Titration: 0.2-1 ug/ml, Positive Control: Rat Brain.

Product Details

Summary
Product Discontinued
View other related Serotonin Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69077
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Serotonin Antibody Summary

Immunogen
Synthetic peptides corresponding to Htr3a (5-hydroxytryptamine (serotonin) receptor 3a) The peptide sequence was selected from the middle region of Htr3a. Peptide sequence PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRH.
Clonality
Polyclonal
Host
Rabbit
Gene
Htr3a
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Htr3a and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Serotonin Antibody

  • 5 HT 5A
  • 5 HT
  • 5 HT5A
  • 5 hydroxytryptamine
  • 5HT

Background

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses in neurons. It is a cation-specific, but otherwise relatively nonselective, ion channel.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Serotonin Antibody (NBP1-69077) (0)

There are no publications for Serotonin Antibody (NBP1-69077).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serotonin Antibody (NBP1-69077) (0)

There are no reviews for Serotonin Antibody (NBP1-69077). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Serotonin Antibody (NBP1-69077) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Serotonin Products

Bioinformatics Tool for Serotonin Antibody (NBP1-69077)

Discover related pathways, diseases and genes to Serotonin Antibody (NBP1-69077). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Serotonin.

How DOPA Decarboxylase Affects Neurotransmitter Synthesis
DOPA decarboxylase (DDC) is responsible for catalyzing the conversion of aromatic amino acids into their corresponding amines during the synthesis of several important neurotransmitters. Specifically, DDC catalyzes the decarboxylation of L-DOPA to...  Read full blog post.

"Freeze!" - Arrestin Antibodies Used in New Serotonin Syndrome Study
The beta-arrestin family regulate receptor binding of G-proteins, a group of seven transmembrane receptor proteins which includes the adrenergic, dopamine and serotonin receptors. Recently, arrestin antibodies were used in a study into Serotonin Syndr...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Serotonin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol Htr3a
Uniprot