SENP2 Antibody


Western Blot: SENP2 Antibody [NBP1-57717] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related SENP2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SENP2 Antibody Summary

Synthetic peptides corresponding to SENP2 (SUMO1/sentrin/SMT3 specific peptidase 2) The peptide sequence was selected from the middle region of SENP2)(50ug). Peptide sequence RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SENP2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SENP2 Antibody

  • AXAM2
  • AXAM2Axam2
  • DKFZp762A2316
  • EC 3.4.22
  • EC
  • KIAA1331sentrin-specific protease 2
  • SENP2
  • Sentrin/SUMO-specific protease SENP2
  • SMT3IP2
  • SMT3IP2EC 3.4.22.-
  • SMT3-specific isopeptidase 2
  • SUMO1/sentrin/SMT3 specific peptidase 2
  • SUMO1/sentrin/SMT3 specific protease 2


SUMO1 (UBL1; MIM 601912) is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IF
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for SENP2 Antibody (NBP1-57717) (0)

There are no publications for SENP2 Antibody (NBP1-57717).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SENP2 Antibody (NBP1-57717) (0)

There are no reviews for SENP2 Antibody (NBP1-57717). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SENP2 Antibody (NBP1-57717) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SENP2 Products

Bioinformatics Tool for SENP2 Antibody (NBP1-57717)

Discover related pathways, diseases and genes to SENP2 Antibody (NBP1-57717). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SENP2 Antibody (NBP1-57717)

Discover more about diseases related to SENP2 Antibody (NBP1-57717).

Pathways for SENP2 Antibody (NBP1-57717)

View related products by pathway.

PTMs for SENP2 Antibody (NBP1-57717)

Learn more about PTMs related to SENP2 Antibody (NBP1-57717).

Blogs on SENP2

There are no specific blogs for SENP2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SENP2 Antibody and receive a gift card or discount.


Gene Symbol SENP2