Recombinant Human Semaphorin 7A Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Semaphorin 7A Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 536-633 of Human Semaphorin 7A

Source: Wheat Germ

Amino Acid Sequence: EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SEMA7A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00008482-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Semaphorin 7A Protein

  • CD108 antigen
  • CD108
  • CD108MGC126696
  • CDw108
  • H-SEMA-K1
  • H-Sema-L
  • JMH blood group antigen
  • JMH
  • John-Milton-Hargen human blood group Ag
  • MGC126692
  • sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin)7A (JMH blood group)
  • sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin)7A
  • sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, 7A
  • Sema K1
  • Sema L
  • Sema7A
  • SEMAK1
  • SEMAL
  • SEMALJohn Milton Hagen blood group H-Sema K1
  • Semaphorin 7A
  • semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
  • semaphorin K1
  • semaphorin L
  • semaphorin-7A
  • semaphorin-K1
  • semaphorin-L

Background

SEMA7A - sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin) 7A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF2009
Species: Hu
Applications: WB, IHC
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF5375
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-25198
Species: Hu
Applications: Flow, IP, Flow-CS
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
AF3749
Species: Hu
Applications: WB, IHC
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF7895
Species: Hu
Applications: WB, IHC
AF4075
Species: Mu, Rt
Applications: WB, IHC
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00008482-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Semaphorin 7A Partial Recombinant Protein (H00008482-Q01)(1)

Reviews for Semaphorin 7A Partial Recombinant Protein (H00008482-Q01) (0)

There are no reviews for Semaphorin 7A Partial Recombinant Protein (H00008482-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Semaphorin 7A Partial Recombinant Protein (H00008482-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Semaphorin 7A Partial Recombinant Protein (H00008482-Q01)

Discover related pathways, diseases and genes to Semaphorin 7A Partial Recombinant Protein (H00008482-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 7A Partial Recombinant Protein (H00008482-Q01)

Discover more about diseases related to Semaphorin 7A Partial Recombinant Protein (H00008482-Q01).
 

Pathways for Semaphorin 7A Partial Recombinant Protein (H00008482-Q01)

View related products by pathway.

PTMs for Semaphorin 7A Partial Recombinant Protein (H00008482-Q01)

Learn more about PTMs related to Semaphorin 7A Partial Recombinant Protein (H00008482-Q01).
 

Research Areas for Semaphorin 7A Partial Recombinant Protein (H00008482-Q01)

Find related products by research area.

Blogs on Semaphorin 7A

There are no specific blogs for Semaphorin 7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Semaphorin 7A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA7A
Entrez