Recombinant Human Semaphorin 6D Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Semaphorin 6D Peptides and Proteins

Order Details


    • Catalog Number
      H00080031-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Semaphorin 6D Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 852-940 of Human SEMA6D partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KLQNIDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMGDIQMAHQNLMLDPMGSMSEVPPKVPNREASLYSPPSTLPRNS

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
SEMA6D

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Semaphorin 6D Protein

  • KIAA1479FLJ11598
  • sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D
  • Sema6D
  • Semaphorin 6D
  • semaphorin-6D

Background

Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphorin domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. This gene encodes a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
AF2108
Species: Mu
Applications: WB, IHC
AF2095
Species: Hu
Applications: WB
MAB5240
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-31551
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF143
Species: Hu
Applications: WB, Simple Western, IHC
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-97587
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-07101
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, ICC/IF
NBP1-92476
Species: Hu
Applications: IHC, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00080031-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Semaphorin 6D Partial Recombinant Protein (H00080031-Q01) (0)

There are no publications for Semaphorin 6D Partial Recombinant Protein (H00080031-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 6D Partial Recombinant Protein (H00080031-Q01) (0)

There are no reviews for Semaphorin 6D Partial Recombinant Protein (H00080031-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Semaphorin 6D Partial Recombinant Protein (H00080031-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Semaphorin 6D Products

Bioinformatics Tool for Semaphorin 6D Partial Recombinant Protein (H00080031-Q01)

Discover related pathways, diseases and genes to Semaphorin 6D Partial Recombinant Protein (H00080031-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 6D Partial Recombinant Protein (H00080031-Q01)

Discover more about diseases related to Semaphorin 6D Partial Recombinant Protein (H00080031-Q01).
 

Pathways for Semaphorin 6D Partial Recombinant Protein (H00080031-Q01)

View related products by pathway.

PTMs for Semaphorin 6D Partial Recombinant Protein (H00080031-Q01)

Learn more about PTMs related to Semaphorin 6D Partial Recombinant Protein (H00080031-Q01).

Blogs on Semaphorin 6D

There are no specific blogs for Semaphorin 6D, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Semaphorin 6D Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA6D
Entrez