Recombinant Human Semaphorin 6A Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Semaphorin 6A Peptides and Proteins

Order Details


    • Catalog Number
      H00057556-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Semaphorin 6A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21-120 of Human SEMA6A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQMIMIMNGTLYIAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
SEMA6A

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Semaphorin 6A Protein

  • KIAA1368HT018
  • sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A
  • Sema VIA
  • SEMA
  • Sema6A
  • SEMA6A1
  • SEMA6A-1
  • Semaphorin 6A
  • semaphorin 6A-1
  • Semaphorin VIA
  • semaphorin-6A
  • semaphorin-6A-1
  • SEMAQ
  • VIA

Background

SEMA6A - sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF567
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NBP1-85128
Species: Hu
Applications: IHC, IHC-P
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
AF2094
Species: Hu, Mu
Applications: WB, IHC
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7109
Species: Mu
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-82527
Species: Hu
Applications: IHC, IHC-P
MAB1728
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Semaphorin 6A Partial Recombinant Protein (H00057556-Q01) (0)

There are no publications for Semaphorin 6A Partial Recombinant Protein (H00057556-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 6A Partial Recombinant Protein (H00057556-Q01) (0)

There are no reviews for Semaphorin 6A Partial Recombinant Protein (H00057556-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Semaphorin 6A Partial Recombinant Protein (H00057556-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Semaphorin 6A Products

Bioinformatics Tool for Semaphorin 6A Partial Recombinant Protein (H00057556-Q01)

Discover related pathways, diseases and genes to Semaphorin 6A Partial Recombinant Protein (H00057556-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 6A Partial Recombinant Protein (H00057556-Q01)

Discover more about diseases related to Semaphorin 6A Partial Recombinant Protein (H00057556-Q01).
 

Pathways for Semaphorin 6A Partial Recombinant Protein (H00057556-Q01)

View related products by pathway.

PTMs for Semaphorin 6A Partial Recombinant Protein (H00057556-Q01)

Learn more about PTMs related to Semaphorin 6A Partial Recombinant Protein (H00057556-Q01).
 

Research Areas for Semaphorin 6A Partial Recombinant Protein (H00057556-Q01)

Find related products by research area.

Blogs on Semaphorin 6A

There are no specific blogs for Semaphorin 6A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Semaphorin 6A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA6A
Entrez