Recombinant Human Semaphorin 5A Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Semaphorin 5A Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 393-499 of Human Semaphorin 5A

Source: Wheat Germ

Amino Acid Sequence: PSFMEDNSRFSHVAVDVVQGREALVHIIYLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVVKIPLKRCQFYRTRSTCIGA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SEMA5A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Semaphorin 5A Protein

  • FLJ12815
  • sema domain, seven thrombospondin repeats (type 1 and type 1-like)
  • Sema F
  • SEMA5A
  • SEMAF
  • Semaphorin 5A
  • semaphorin F
  • semaphorin-5A
  • Semaphorin-F
  • semF
  • transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A

Background

SEMA5A - sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5896
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
AF6879
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-85467
Species: Hu
Applications: WB, IHC, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP2-02852
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00001501-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-25198
Species: Hu
Applications: Flow, IP, Flow-CS
NBP2-15016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF567
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
MAB1144
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-32740
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Semaphorin 5A Partial Recombinant Protein (H00009037-Q01) (0)

There are no publications for Semaphorin 5A Partial Recombinant Protein (H00009037-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 5A Partial Recombinant Protein (H00009037-Q01) (0)

There are no reviews for Semaphorin 5A Partial Recombinant Protein (H00009037-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Semaphorin 5A Partial Recombinant Protein (H00009037-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Semaphorin 5A Partial Recombinant Protein (H00009037-Q01)

Discover related pathways, diseases and genes to Semaphorin 5A Partial Recombinant Protein (H00009037-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 5A Partial Recombinant Protein (H00009037-Q01)

Discover more about diseases related to Semaphorin 5A Partial Recombinant Protein (H00009037-Q01).
 

Pathways for Semaphorin 5A Partial Recombinant Protein (H00009037-Q01)

View related products by pathway.

PTMs for Semaphorin 5A Partial Recombinant Protein (H00009037-Q01)

Learn more about PTMs related to Semaphorin 5A Partial Recombinant Protein (H00009037-Q01).
 

Research Areas for Semaphorin 5A Partial Recombinant Protein (H00009037-Q01)

Find related products by research area.

Blogs on Semaphorin 5A

There are no specific blogs for Semaphorin 5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Semaphorin 5A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA5A