Recombinant Human Semaphorin 4G Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Semaphorin 4G Peptides and Proteins

Order Details


    • Catalog Number
      H00057715-P02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Semaphorin 4G Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-127 of Human SEMA4G full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGSMSPPSAWPCVLDGPETRQDLCQPPKPCVHSHAHMEECLSAGLQCPHPHLLLVHSCFIPASGLGVPSQLPHPIWSSSPAPCGDLFVKSLGTGQPGEVRLHHSPPLPSCVALVNQPPHSPWSFSRV

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
SEMA4G

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Semaphorin 4G Protein

  • KIAA1619FLJ20590
  • MGC102867
  • sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and shortcytoplasmic domain, (semaphorin) 4G
  • SEMA4G
  • Semaphorin 4G
  • semaphorin-4G

Background

Semaphorins are a large family of conserved secreted and membrane associated proteins which possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Based on sequence and structural similarities, semaphorins are put into eight classes: invertebrates contain classes 1 and 2, viruses have class V, and vertebrates contain classes 3-7. Semaphorins serve as axon guidance ligands via multimeric receptor complexes, some (if not all) containing plexin proteins. This gene encodes a class 4 semaphorin. This gene and the gene for mitochondrial ribosomal protein L43 overlap at map location 10q24.31 and are transcribed in opposite directions. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-13659
Species: Hu
Applications: IHC, IHC-P
AF5329
Species: Hu
Applications: WB, IHC
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP1-92275
Species: Hu
Applications: IHC, IHC-P
AF6817
Species: Hu
Applications: WB
NBP2-25198
Species: Hu
Applications: Flow, IP, Flow-CS
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-56919
Species: Hu
Applications: WB
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00057715-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for Semaphorin 4G Recombinant Protein (H00057715-P02) (0)

There are no publications for Semaphorin 4G Recombinant Protein (H00057715-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Semaphorin 4G Recombinant Protein (H00057715-P02) (0)

There are no reviews for Semaphorin 4G Recombinant Protein (H00057715-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Semaphorin 4G Recombinant Protein (H00057715-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Semaphorin 4G Products

Bioinformatics Tool for Semaphorin 4G Recombinant Protein (H00057715-P02)

Discover related pathways, diseases and genes to Semaphorin 4G Recombinant Protein (H00057715-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Semaphorin 4G Recombinant Protein (H00057715-P02)

Discover more about diseases related to Semaphorin 4G Recombinant Protein (H00057715-P02).
 

Pathways for Semaphorin 4G Recombinant Protein (H00057715-P02)

View related products by pathway.

Research Areas for Semaphorin 4G Recombinant Protein (H00057715-P02)

Find related products by research area.

Blogs on Semaphorin 4G

There are no specific blogs for Semaphorin 4G, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Semaphorin 4G Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SEMA4G
Entrez