Recombinant Human SEC24A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SEC24A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 301-390 of Human SEC24A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PLTSSYRDVPQPLFNSAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQNTTPPGATGVPPSSL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SEC24A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SEC24A Protein

  • member A
  • protein transport protein Sec24A
  • SEC24 family, member A (S. cerevisiae)
  • SEC24-related protein A

Background

In yeast, the Sec23-Sec24 complex is a component of coat protein II (COPII; see MIM 601924)-coated vesicles that mediate protein transport from the endoplasmic reticulum. SEC24A is 1 of several mammalian proteins that show structural and functional homology to yeast Sec24.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86263
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009871-M04
Species: Hu
Applications: WB, ELISA
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00011236-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB2476
Species: Hu
Applications: WB, IHC
1407-PI
Species: Hu
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
AF4146
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01828
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34842
Species: Hu, Mu, Rt, Ha
Applications: WB, Flow, ICC/IF, IP

Publications for SEC24A Partial Recombinant Protein (H00010802-Q01) (0)

There are no publications for SEC24A Partial Recombinant Protein (H00010802-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SEC24A Partial Recombinant Protein (H00010802-Q01) (0)

There are no reviews for SEC24A Partial Recombinant Protein (H00010802-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SEC24A Partial Recombinant Protein (H00010802-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SEC24A Products

SEC24A H00010802-Q01

Bioinformatics Tool for SEC24A Partial Recombinant Protein (H00010802-Q01)

Discover related pathways, diseases and genes to SEC24A Partial Recombinant Protein (H00010802-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SEC24A Partial Recombinant Protein (H00010802-Q01)

Discover more about diseases related to SEC24A Partial Recombinant Protein (H00010802-Q01).
 

Pathways for SEC24A Partial Recombinant Protein (H00010802-Q01)

View related products by pathway.

PTMs for SEC24A Partial Recombinant Protein (H00010802-Q01)

Learn more about PTMs related to SEC24A Partial Recombinant Protein (H00010802-Q01).

Blogs on SEC24A

There are no specific blogs for SEC24A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATF6 Antibody (70B1413.1)
NBP1-40256-0.1mg
SEC24A Antibody
NBP2-58626
FANCD2 Antibody
NB100-182

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SEC24A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SEC24A