SDF4 Antibody

Images

 
Western Blot: SDF4 Antibody [NBP1-69587] - This Anti-SDF4 antibody was used in Western Blot of Fetal Small Intestine tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Product Discontinued
View other related SDF4 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69587
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SDF4 Antibody Summary

Immunogen
Synthetic peptides corresponding to SDF4(stromal cell derived factor 4) The peptide sequence was selected from the middle region of SDF4. Peptide sequence KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEE.
Clonality
Polyclonal
Host
Rabbit
Gene
SDF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SDF4 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SDF4 Antibody

  • 45 kDa calcium-binding protein
  • CAB45
  • Cab45Stromal cell-derived factor 4
  • calcium binding protein
  • SDF-4
  • stromal cell derived factor 4

Background

SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90348
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32010
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006388-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-84972
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15131
Species: Hu
Applications: WB
NBP1-19344
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24464
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC-P
MAB2568
Species: Mu
Applications: WB, IHC
NBP1-83483
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01446
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
1169-FR/CF
Species: Mu
NBP1-90854
Species: Hu
Applications: IHC, IHC-P
NBP1-76995
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-69587
Species: Hu
Applications: WB

Publications for SDF4 Antibody (NBP1-69587) (0)

There are no publications for SDF4 Antibody (NBP1-69587).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SDF4 Antibody (NBP1-69587) (0)

There are no reviews for SDF4 Antibody (NBP1-69587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SDF4 Antibody (NBP1-69587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SDF4 Products

Bioinformatics Tool for SDF4 Antibody (NBP1-69587)

Discover related pathways, diseases and genes to SDF4 Antibody (NBP1-69587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SDF4 Antibody (NBP1-69587)

Discover more about diseases related to SDF4 Antibody (NBP1-69587).
 

Pathways for SDF4 Antibody (NBP1-69587)

View related products by pathway.

Blogs on SDF4

There are no specific blogs for SDF4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SDF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SDF4
Uniprot