Recombinant Human SCUBE3 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related SCUBE3 Peptides and Proteins

Order Details


    • Catalog Number
      H00222663-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human SCUBE3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 29 - 147 of Human SCUBE3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGSYECHCREGFFLSDN

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
SCUBE3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCUBE3 Protein

  • CEGF3
  • CUB and EGF containing protein 3
  • CUB domain and EGF-like repeat containing 3
  • DKFZp686B09105
  • DKFZp686B1223
  • DKFZp686D20108
  • FLJ34743
  • SCUBE3
  • signal peptide, CUB and EGF-like domain containing protein 3
  • signal peptide, CUB and EGF-like domain-containing protein 3
  • signal peptide, CUB domain, EGF-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77186
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IF
AF1807
Species: Hu
Applications: WB, IP
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP2-01625
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-13780
Species: Hu
Applications: IHC, IHC-P
MAB1774
Species: Hu
Applications: Flow, CyTOF-ready, ICC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-57016
Species: Hu
Applications: WB
NBP2-45995
Species: Hu
Applications: WB, IHC
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-85085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00222663-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for SCUBE3 Partial Recombinant Protein (H00222663-Q02) (0)

There are no publications for SCUBE3 Partial Recombinant Protein (H00222663-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCUBE3 Partial Recombinant Protein (H00222663-Q02) (0)

There are no reviews for SCUBE3 Partial Recombinant Protein (H00222663-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCUBE3 Partial Recombinant Protein (H00222663-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCUBE3 Products

Bioinformatics Tool for SCUBE3 Partial Recombinant Protein (H00222663-Q02)

Discover related pathways, diseases and genes to SCUBE3 Partial Recombinant Protein (H00222663-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCUBE3 Partial Recombinant Protein (H00222663-Q02)

Discover more about diseases related to SCUBE3 Partial Recombinant Protein (H00222663-Q02).
 

Pathways for SCUBE3 Partial Recombinant Protein (H00222663-Q02)

View related products by pathway.

PTMs for SCUBE3 Partial Recombinant Protein (H00222663-Q02)

Learn more about PTMs related to SCUBE3 Partial Recombinant Protein (H00222663-Q02).

Blogs on SCUBE3

There are no specific blogs for SCUBE3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCUBE3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCUBE3
Entrez