SCO1 Antibody

Images

 
Western Blot: SCO1 Antibody [NBP1-54387] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Product Details

Summary
Product Discontinued
View other related SCO1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54387
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SCO1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SCO1(SCO cytochrome oxidase deficient homolog 1 (yeast)) The peptide sequence was selected from the middle region of SCO1. Peptide sequence ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL.
Clonality
Polyclonal
Host
Rabbit
Gene
SCO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SCO1 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SCO1 Antibody

  • protein SCO1 homolog, mitochondrial
  • SCO cytochrome oxidase deficient homolog 1 (yeast)
  • SCOD1SCO (cytochrome oxidase deficient, yeast) homolog 1

Background

Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytoch

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77274
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-30388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
H00001353-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-86322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006834-T01
Species: Hu
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-88677
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009973-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-59560
Species: Hu
Applications: WB, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54387
Species: Hu
Applications: WB

Publications for SCO1 Antibody (NBP1-54387) (0)

There are no publications for SCO1 Antibody (NBP1-54387).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCO1 Antibody (NBP1-54387) (0)

There are no reviews for SCO1 Antibody (NBP1-54387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCO1 Antibody (NBP1-54387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCO1 Products

Bioinformatics Tool for SCO1 Antibody (NBP1-54387)

Discover related pathways, diseases and genes to SCO1 Antibody (NBP1-54387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCO1 Antibody (NBP1-54387)

Discover more about diseases related to SCO1 Antibody (NBP1-54387).
 

Pathways for SCO1 Antibody (NBP1-54387)

View related products by pathway.

PTMs for SCO1 Antibody (NBP1-54387)

Learn more about PTMs related to SCO1 Antibody (NBP1-54387).

Blogs on SCO1

There are no specific blogs for SCO1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCO1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCO1
Uniprot