SCNM1 Antibody

Images

 
Western Blot: SCNM1 Antibody [NBP2-88223] - Host: Rabbit. Target Name: SCNM1. Sample Tissue: Human HCT116 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SCNM1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SCNM1. Peptide sequence: SLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SCNM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SCNM1 Antibody

  • MGC3180
  • sodium channel modifier 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-84177
Species: Hu
Applications: IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP1-84185
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89932
Species: Hu
Applications: IHC, IHC-P
H00006326-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-57487
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-01446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-33621
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-45224
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-92692
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF470
Species: Mu
Applications: IHC, Neut, WB
NBP1-77227
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
8297-GG/CF
Species: Hu
Applications: BA
MAB935
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
NBP2-67584
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for SCNM1 Antibody (NBP2-88223) (0)

There are no publications for SCNM1 Antibody (NBP2-88223).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCNM1 Antibody (NBP2-88223) (0)

There are no reviews for SCNM1 Antibody (NBP2-88223). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCNM1 Antibody (NBP2-88223) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCNM1 Products

Bioinformatics Tool for SCNM1 Antibody (NBP2-88223)

Discover related pathways, diseases and genes to SCNM1 Antibody (NBP2-88223). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCNM1 Antibody (NBP2-88223)

Discover more about diseases related to SCNM1 Antibody (NBP2-88223).
 

Pathways for SCNM1 Antibody (NBP2-88223)

View related products by pathway.

Blogs on SCNM1

There are no specific blogs for SCNM1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCNM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNM1