SCML1 Antibody (4G3) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related SCML1 Primary Antibodies

Order Details


    • Catalog Number
      H00006322-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SCML1 Antibody (4G3) [DyLight 488] Summary

Immunogen
SCML1 (NP_006737 3 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHN
Specificity
SCML1 - sex comb on midleg-like 1 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SCML1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SCML1 Antibody (4G3) [DyLight 488]

  • sex comb on midleg (Drosophila)-like 1
  • sex comb on midleg-like 1 (Drosophila)
  • sex comb on midleg-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45725
Species: Hu
Applications: WB, IHC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45724
Species: Hu
Applications: WB, IHC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00006247-B01P
Species: Hu
Applications: WB
NBP2-12899
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-32157
Species: Hu
Applications: WB, IHC-P, IP
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-80891
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87239
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80811
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00006322-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for SCML1 Antibody (H00006322-M01G) (0)

There are no publications for SCML1 Antibody (H00006322-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCML1 Antibody (H00006322-M01G) (0)

There are no reviews for SCML1 Antibody (H00006322-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SCML1 Antibody (H00006322-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SCML1 Products

Bioinformatics Tool for SCML1 Antibody (H00006322-M01G)

Discover related pathways, diseases and genes to SCML1 Antibody (H00006322-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SCML1 Antibody (H00006322-M01G)

Discover more about diseases related to SCML1 Antibody (H00006322-M01G).
 

Pathways for SCML1 Antibody (H00006322-M01G)

View related products by pathway.

PTMs for SCML1 Antibody (H00006322-M01G)

Learn more about PTMs related to SCML1 Antibody (H00006322-M01G).

Blogs on SCML1

There are no specific blogs for SCML1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SCML1 Antibody (4G3) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol SCML1